Property Summary

Ligand Count 11
NCBI Gene PubMed Count 19
PubMed Score 22.65
PubTator Score 19.02

Knowledge Summary

Patent (4,871)

TINX Plot

  Disease (3)

Disease Target Count
Papillary thyroid carcinoma 43
Disease Target Count P-value
ependymoma 4679 1.7e-08
malignant mesothelioma 3232 1.2e-06
psoriasis 6694 4.8e-04
Astrocytoma, Pilocytic 3081 7.4e-04
group 3 medulloblastoma 4104 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 7.4e-04
ependymoma 2.700 1.7e-08
group 3 medulloblastoma 2.500 6.7e-03
malignant mesothelioma 1.500 1.2e-06
psoriasis -1.900 4.8e-04

Gene RIF (7)

AA Sequence

MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKM      1 - 70
RSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAI     71 - 140
VYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEV    141 - 210
VGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAI    211 - 280
TNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQ    281 - 350
EEVSDQTTNNGGELMLESTF                                                      351 - 370
//

Text Mined References (20)

PMID Year Title