Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 7
Funding $1,098,677.63
PubMed Score 20.69
PubTator Score 19.02

Knowledge Summary

Patent (4,871)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis -1.900 0.000
ependymoma 2.700 0.000
group 3 medulloblastoma 2.500 0.007
pilocytic astrocytoma 1.200 0.001

Gene RIF (6)

PMID Text
25849892 These results suggest that the diverse roles of LPA4, LPA5 and LPA6 are involved in the activation of tumor progression in pancreatic cancer cells.
23467751 Our data suggest that LPA4 signaling potentially modulates malignant behavior of SQ-20B cells.
20890765 LPA4 gene mutation may play some role in the pathogenesis of colon cancer.
20069565 LPA4 and LPA5 receptors induce osteoblastic differentiation of human mesenchymal stem cells
19860625 Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients.
12724320 identified as the fourth lysophosphatidic acid (LPA) receptor; shares only 20-24% amino acid identities with Edg-2/LPA1, Edg-4/LPA2, and Edg-7/LPA3, and phylogenetic analysis also shows that p2y9/GPR23 is far distant from the Edg family

AA Sequence

MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKM      1 - 70
RSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAI     71 - 140
VYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEV    141 - 210
VGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAI    211 - 280
TNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQ    281 - 350
EEVSDQTTNNGGELMLESTF                                                      351 - 370
//

Text Mined References (19)

PMID Year Title
25849892 2015 Diverse effects of LPA4, LPA5 and LPA6 on the activation of tumor progression in pancreatic cancer cells.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23467751 2013 Lysophosphatidic acid receptor 4 signaling potentially modulates malignant behavior in human head and neck squamous cell carcinoma cells.
20890765 2010 Differential expressions and DNA methylation patterns of lysophosphatidic acid receptor genes in human colon cancer cells.
20069565 2010 LPA induces osteoblast differentiation through interplay of two receptors: LPA1 and LPA4.
19860625 2009 Lysophosphatidic acid receptor expression in chronic lymphocytic leukemia leads to cell survival mediated though vascular endothelial growth factor expression.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
More...