Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.01
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 6.65636062031102E-11
atypical teratoid / rhabdoid tumor 4369 7.03394699985158E-6
lung cancer 4473 1.04116064994136E-5
medulloblastoma 1524 5.96313427295124E-5
adult high grade glioma 2148 1.11223724073469E-4
glioblastoma 5572 5.53308638262545E-4
primitive neuroectodermal tumor 3031 0.00132083414026047
lung adenocarcinoma 2714 0.00349382498940053
colon cancer 1475 0.00362960514906398
astrocytic glioma 2241 0.0080573854087329
medulloblastoma, large-cell 6234 0.0140216951742625
Disease Target Count Z-score Confidence
Dermatitis herpetiformis 11 3.308 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 0.008
ependymoma -1.700 0.000
glioblastoma -1.500 0.001
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.100 0.014
primitive neuroectodermal tumor -1.600 0.001
lung cancer 3.300 0.000
colon cancer 1.700 0.004
adult high grade glioma -1.900 0.000
lung adenocarcinoma 1.200 0.003

Synonym

Accession Q99674 A6NHV7 B4DXY8 B5MCB7 B5MCC9 B5MCP5 E7EU99 Q8N4B7
Symbols CGR11

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (4)

PMID Text
26022276 Results clearly indicated that CGREF1 is a novel secretory protein, and plays an important role in regulation of AP-1 transcriptional activity and cell proliferation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of cell growth regulator with EF-hand domain 1 (CGREF1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSR      1 - 70
EQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELI     71 - 140
NFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGG    141 - 210
QAEADGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETL    211 - 280
ESKNTQNDFEVHIVQVENDEI                                                     281 - 301
//

Text Mined References (12)

PMID Year Title
26022276 2015 The novel secretory protein CGREF1 inhibits the activation of AP-1 transcriptional activity and cell proliferation.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...