Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.01
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Dermatitis herpetiformis 12 3.198 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 1.1e-04
astrocytic glioma -1.300 8.1e-03
atypical teratoid / rhabdoid tumor -1.800 7.0e-06
colon cancer 1.700 3.6e-03
ependymoma -1.500 9.1e-03
glioblastoma -1.100 3.4e-04
group 3 medulloblastoma -1.100 4.9e-02
lung adenocarcinoma 1.200 3.5e-03
lung cancer 3.300 1.0e-05
medulloblastoma, large-cell -1.100 1.4e-02
primitive neuroectodermal tumor -1.600 1.3e-03

Gene RIF (4)

AA Sequence

MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSR      1 - 70
EQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELI     71 - 140
NFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGG    141 - 210
QAEADGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETL    211 - 280
ESKNTQNDFEVHIVQVENDEI                                                     281 - 301
//

Text Mined References (12)

PMID Year Title