Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.02
PubTator Score 4.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.049
hepatocellular carcinoma -1.500 0.010
astrocytic glioma 1.100 0.034
ependymoma 1.500 0.019
oligodendroglioma 1.100 0.034
osteosarcoma 1.031 0.003
atypical teratoid / rhabdoid tumor -1.100 0.014
glioblastoma -1.300 0.013
medulloblastoma, large-cell -1.300 0.001
adrenocortical carcinoma -1.751 0.002
intraductal papillary-mucinous adenoma (... 1.300 0.006
intraductal papillary-mucinous carcinoma... 2.000 0.001
psoriasis -2.200 0.000
Alzheimer's disease 1.400 0.041
Pick disease 2.000 0.000
progressive supranuclear palsy 1.600 0.019
ovarian cancer -3.100 0.000
pituitary cancer -2.200 0.000

Gene RIF (1)

PMID Text
18187620 Knockdown of RANBP2-like and GRIP domain containing 5 (RGPD5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLY      1 - 70
ELEENTEKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLD     71 - 140
CEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKRLKDAVAHCHEAERNIALRSSLEWNSCVVQT    141 - 210
LKEYLESLQCLESDKSDWQATNTDLLLAYANLMLLTLSTRDVQENRELLESFDSALQSAKSSLGGNDELS    211 - 280
ATFLEMKGHFYMYAGSLLLKMGQHGNNVQWRALSELAALCYLIAFQVPRPKIKLREGKAGQNLLEMMACD    281 - 350
RLSQSGHMLLSLSRGKQDFLKEVVETFANKIGQSALYDALFSSQSPKDTSFLGSDDIGKIDVQEPELEDL    351 - 420
ARYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHRLPHETSRLETNAPESICILDLEVFLL    421 - 490
GVVYTSHLQLKEKCNSHHSSYQPLCLPFPVCKQLCTERQKSWWDAVCTLIHRKAVPGNLAKLRLLVQHEI    491 - 560
NTLRAQEKHGLQPALLVHWAKYLQKTGSGLNSFYGQLEYIGRSVHYWKKVLPLLKIIKKNSIPEPIDPLF    561 - 630
KHFHSVDIQASEIVEYEEDAHITFAMLDAVNGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALS    631 - 700
PEEQEECRNYLTKTRDYLIKIIDDGDSNLSVVKKLPVPLESVKQMLNSVMQELEDYSEGGPLYKNGSLRN    701 - 770
ADSEIKHSTPSPTKYSLSPSKSYKYSPETPPRWTEDRNSLLNMICQQVEAIKKEMQELKLNSSKSASRHR    771 - 840
WPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNTEFKSTK    841 - 910
EGFSIPVSADGFKFGISEPGNQEKKREKPLENDTGFQAQDISGRKKGRGVIFGQTSSTFTFADVAKSTSG    911 - 980
EGFQFGKKDLNFKGFSGAGEKLFSSRYGKMANKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMPEKVELV    981 - 1050
TGEEGEKVLYSQGVKLFRFDAEVRQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLK   1051 - 1120
PLSGSDRAWMWSASDFSDGDAKLERLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKL   1121 - 1190
IQRAEEMKSGLKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNAENTGPTLEWDNYDLREDALDD   1191 - 1260
SVSSSSVHASPLASSPVRKNLFRFDESTTGSNFSFKSALSLSKSPAKLNQSGTSVGTDEESVVTQEEERD   1261 - 1330
GQYFEPVVPLPDLVEVSSGEENEQVVFSHRAEIYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQ   1331 - 1400
VLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKTAQEKD   1401 - 1470
SLITPHVSRSSTPRESPCGKIAVAILEETTRERTDVIQGDDVADAASEVEVSSTSETTTKAVVSPPKFVF   1471 - 1540
VSESVKRIFSSEKSKPFVFGNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIE   1541 - 1610
QSSDSKVKNLSASFPTEESSINYTFKTPEKEPPLWHAEFTKEELVQKLRSTTKSADHLNGLLREIEATNA   1611 - 1680
VLMEQIKLLKSEIRRLERNQEREKSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLA   1681 - 1750
AVAQDEEENASRSSG                                                          1751 - 1765
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15710750 2005 Complex genomic rearrangements lead to novel primate gene function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12905863 2001 [Determination of the binding site of testis-specific nucleoporin BS-63 to transportin (karopherin beta 2) and the proof of their combination in vitro].
11774384 2002 Characterization and potential function of a novel testis-specific nucleoporin BS-63.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...