Property Summary

NCBI Gene PubMed Count 79
Grant Count 13
R01 Count 10
Funding $832,274.66
PubMed Score 29.58
PubTator Score 46.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (62)

PMID Text
26552659 The effects of rs3762315 and rs3762316 single nucleotide polymorphisms in 5' flanking region on IL12RB2 transcription
26547104 IL12RB2 polymorphisms correlate with risk of lung adenocarcinoma.
25720506 IL12RB2 polymorphism is associated with systemic lupus erythematosus in the Chinese population.
25695486 Estrogen receptor beta 2 regulates IL12RB2 expression via p38 MAPK signaling and inhibits non-small-cell lung cancer proliferation and invasion.
24859272 Genetic variations of IL-12B, IL-12Rbeta1, IL-12Rbeta2 in Behcet's disease and VKH syndrome.
24486579 Polymorphisms present in the promoter region of IL12RB2 may not be associated with susceptibility to leprosy or its clinical forms.
24434271 results suggest the rs924080 risk A allele does not affect baseline expression of IL-12RB2, IL-23R, IFN-gamma and TNF-alpha but enhances IL-23R and TNF-alpha expression capacity in response to LPS stimulation; the A allele appears to enhance baseline IL-6 production
23911393 Data indicate that four of the IL-12Rbeta2 variants, N271Y, R313G, A604V and L808R showed reduced IL-12 responses compared to the wild type variant.
23677568 ERbeta2 and IL-12Rbeta5 had longer OS.
23152861 Association of IL12RB2 rs6679356 polymorphism with the age of type 1 diabetes mellitus onset suggests that this gene plays a role in defining the time of disease onset.
More...

AA Sequence

MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLIL      1 - 70
YKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGT     71 - 140
VACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSS    141 - 210
SLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHD    211 - 280
LLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSV    281 - 350
SEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG    351 - 420
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIK    421 - 490
SYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYW    491 - 560
KERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPS    561 - 630
ICIAIIMVGIFSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPE    631 - 700
DPEPLVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVL    701 - 770
ESRGSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL    771 - 840
TFSCGDKLTLDQLKMRCDSLML                                                    841 - 862
//

Text Mined References (80)

PMID Year Title
26552659 2016 Functional analysis of differences in transcriptional activity conferred by genetic variants in the 5' flanking region of the IL12RB2 gene.
26547104 2016 IL12RB2 Polymorphisms correlate with risk of lung adenocarcinoma.
25720506 2015 Autoimmune risk loci of IL12RB2, IKZF1, XKR6, TMEM39A and CSK in Chinese patients with systemic lupus erythematosus.
25695486 2015 Estrogen receptor?2 regulates interlukin-12 receptor?2 expression via p38 mitogen-activated protein kinase signaling and inhibits non-small-cell lung cancer proliferation and invasion.
24859272 2014 Genetic variations of IL-12B, IL-12R?1, IL-12R?2 in Behcet's disease and VKH syndrome.
24486579 2014 Polymorphisms assessment in the promoter region of IL12RB2 in Amazon leprosy patients.
24434271 2014 Increased IL-23 receptor, TNF-? and IL-6 expression in individuals with the IL23R-IL12RB2 locus polymorphism.
23911393 2013 Differential expression and function of human IL-12R?2 polymorphic variants.
23677568 2013 The co-expression of ER?2 and IL-12R?2 is better prognostic factor in non-small-cell lung cancer progression.
23152861 2012 IL12RB2 gene is associated with the age of type 1 diabetes onset in Croatian family Trios.
More...