Property Summary

NCBI Gene PubMed Count 85
PubMed Score 32.62
PubTator Score 46.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -2.300 5.0e-02
Astrocytoma, Pilocytic -1.200 1.5e-03
Atopic dermatitis 1.100 2.3e-03
atypical teratoid / rhabdoid tumor -1.500 6.8e-05
cutaneous lupus erythematosus 1.300 1.3e-02
cystic fibrosis 1.100 1.1e-03
ependymoma -1.200 3.2e-08
glioblastoma -1.100 3.9e-05
medulloblastoma -1.400 6.9e-04
pediatric high grade glioma -1.100 3.5e-03
primitive neuroectodermal tumor -1.700 4.5e-03
psoriasis 1.200 3.7e-10
pulmonary arterial hypertension -2.500 4.5e-02

Protein-protein Interaction (2)

Gene RIF (68)

AA Sequence

MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLIL      1 - 70
YKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGT     71 - 140
VACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSS    141 - 210
SLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHD    211 - 280
LLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSV    281 - 350
SEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG    351 - 420
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIK    421 - 490
SYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYW    491 - 560
KERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPS    561 - 630
ICIAIIMVGIFSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPE    631 - 700
DPEPLVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVL    701 - 770
ESRGSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL    771 - 840
TFSCGDKLTLDQLKMRCDSLML                                                    841 - 862
//

Text Mined References (86)

PMID Year Title