Property Summary

NCBI Gene PubMed Count 81
PubMed Score 131.93
PubTator Score 126.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Contact Dermatitis 80
Disease Target Count P-value
non-small cell lung cancer 2798 8.54266345501594E-36
atypical teratoid / rhabdoid tumor 4369 4.8913905953084E-11
ovarian cancer 8492 1.12197130843655E-9
posterior fossa group A ependymoma 1511 3.65437137800179E-9
group 3 medulloblastoma 2254 3.04284287606207E-8
malignant mesothelioma 3163 3.94882614866871E-8
pediatric high grade glioma 2712 2.77923142181219E-7
lung adenocarcinoma 2714 4.39256056295185E-7
medulloblastoma, large-cell 6234 3.06321742747558E-6
primitive neuroectodermal tumor 3031 3.3271446544929E-5
invasive ductal carcinoma 2950 3.54244226466507E-5
Atopic dermatitis 944 6.42048067255868E-5
glioblastoma 5572 1.10413111720904E-4
breast carcinoma 1614 1.61856556921019E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.04313968981699E-4
inflammatory breast cancer 404 2.42882617168058E-4
psoriasis 6685 2.59894053735501E-4
lung cancer 4473 2.94131251101532E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00123715346534013
adrenocortical carcinoma 1427 0.00150007032404317
ductal carcinoma in situ 1745 0.00160471166568565
colon cancer 1475 0.00394332164258216
Endometriosis 535 0.0188405264978712
Disease Target Count Z-score Confidence
Cancer 2346 3.312 1.7

Expression

Synonym

Accession Q99661 B3ITR9 Q5JR88 Q6ICU1 Q96C18 Q96HB8 Q9BWV8
Symbols MCAK
CT139
KNSL6

Gene

PDB

2HEH   4UBF   4Y05  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (48)

PMID Text
26206521 the Aurora B-PLK1 signaling at the kinetochore orchestrates MCAK activity, which is essential for timely correction of aberrant kinetochore attachment to ensure accurate chromosome segregation during mitosis.
26148251 MCAK is involved in directional migration and invasion of tumor cells.
26055718 These results demonstrate that the structural change of Kif2C-ATP upon binding to microtubule ends is sufficient for tubulin release, whereas ATP hydrolysis is not required
25504441 MCAK activity is modulated by Plk1 phosphorylation on S632/S633 in mitosis.
25002679 A Rac1-Aurora A-MCAK signaling pathway mediates endothelial cell polarization and directional migration by promoting regional differences in microtubule dynamics.
25002494 up-regulation of KIF2C and KIF2A by ERK1/2 caused aberrant lysosomal positioning and mTORC1 activity in a mutant K-Ras-dependent cancer and cancer model.
24931513 this study suggests a new mechanism by which Plk1 regulates MCAK: by regulating its degradation and hence controlling its turnover in mitosis.
24847103 A dynamic interaction of MCAK-TIP150 orchestrated by Aurora A-mediated phosphorylation governs entosis via regulating microtubule plus-end dynamics and cell rigidity.
24240690 Ras regulates KIF2C to control cell migration pathways in transformed human bronchial epithelial cells.
23891108 A CENP-E mediated wall-tethering event and a MCAK-mediated wall-removing event show that human chromosome-microtubule attachment is achieved through a set of deterministic sequential events rather than stochastic direct capture of microtubule ends.
More...

AA Sequence

MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQ      1 - 70
LLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSR     71 - 140
KQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKEVEKMKNKREEKKA    141 - 210
QNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDV    211 - 280
ISIPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQT    281 - 350
GSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLR    351 - 420
VLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSL    421 - 490
VDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTC    491 - 560
MIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQ    561 - 630
MSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDV    631 - 700
IKALRLAMQLEEQASRQISSKKRPQ                                                 701 - 725
//

Text Mined References (90)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26206521 2015 Spatiotemporal dynamics of Aurora B-PLK1-MCAK signaling axis orchestrates kinetochore bi-orientation and faithful chromosome segregation.
26148251 2015 Functional analysis of phosphorylation of the mitotic centromere-associated kinesin by Aurora B kinase in human tumor cells.
26055718 2015 New Insights into the Coupling between Microtubule Depolymerization and ATP Hydrolysis by Kinesin-13 Protein Kif2C.
25504441 2015 The activity regulation of the mitotic centromere-associated kinesin by Polo-like kinase 1.
25002679 2014 Rac1 and Aurora A regulate MCAK to polarize microtubule growth in migrating endothelial cells.
25002494 2014 Ras transformation uncouples the kinesin-coordinated cellular nutrient response.
24931513 2014 Polo-like kinase 1 regulates the stability of the mitotic centromere-associated kinesin in mitosis.
24847103 2014 Aurora A orchestrates entosis by regulating a dynamic MCAK-TIP150 interaction.
More...