Property Summary

NCBI Gene PubMed Count 89
PubMed Score 136.33
PubTator Score 126.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.818 1.5e-03
adult high grade glioma 1.900 1.4e-04
Atopic dermatitis 1.400 6.4e-05
atypical teratoid / rhabdoid tumor 2.700 4.9e-11
Breast cancer 2.400 1.1e-14
breast carcinoma 1.400 1.6e-04
colon cancer 1.900 3.9e-03
ductal carcinoma in situ 1.900 1.6e-03
Endometriosis 1.041 1.1e-02
ependymoma 1.500 5.7e-10
glioblastoma 2.500 1.6e-09
group 3 medulloblastoma 3.400 3.0e-08
intraductal papillary-mucinous carcinoma... 2.100 2.0e-04
intraductal papillary-mucinous neoplasm ... 2.300 1.2e-03
invasive ductal carcinoma 2.800 3.5e-05
lung adenocarcinoma 1.200 1.1e-11
lung cancer 1.700 2.9e-04
malignant mesothelioma 2.000 3.9e-08
medulloblastoma, large-cell 3.300 3.1e-06
non-small cell lung cancer 3.295 8.5e-36
ovarian cancer 2.700 1.1e-09
primitive neuroectodermal tumor 2.700 3.3e-05
psoriasis 2.200 2.6e-04

Gene RIF (56)

AA Sequence

MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQ      1 - 70
LLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSR     71 - 140
KQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKEVEKMKNKREEKKA    141 - 210
QNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDV    211 - 280
ISIPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQT    281 - 350
GSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLR    351 - 420
VLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSL    421 - 490
VDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTC    491 - 560
MIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQ    561 - 630
MSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDV    631 - 700
IKALRLAMQLEEQASRQISSKKRPQ                                                 701 - 725
//

Text Mined References (98)

PMID Year Title