Property Summary

NCBI Gene PubMed Count 28
PubMed Score 41.88
PubTator Score 517.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 6.6e-06
gastric carcinoma -1.500 2.2e-02
glioblastoma -1.400 4.8e-06
group 3 medulloblastoma -1.300 2.4e-03
interstitial cystitis -1.100 1.3e-03
lung cancer -1.200 1.4e-04
medulloblastoma, large-cell -2.500 1.2e-05
Multiple myeloma 1.570 6.3e-04
osteosarcoma -1.365 1.3e-05
ovarian cancer -2.700 8.0e-10
pancreatic ductal adenocarcinoma liver m... -1.425 4.0e-02
primitive neuroectodermal tumor -1.200 1.5e-03
psoriasis -2.100 1.1e-04
ulcerative colitis -1.600 5.8e-05
Waldenstrons macroglobulinemia 1.019 1.1e-02

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF      1 - 70
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR     71 - 140
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH                   141 - 195
//

Text Mined References (33)

PMID Year Title