Property Summary

NCBI Gene PubMed Count 28
Grant Count 20
R01 Count 11
Funding $3,086,797.93
PubMed Score 34.92
PubTator Score 517.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ulcerative colitis -1.600 0.000
Waldenstrons macroglobulinemia 1.019 0.011
Multiple myeloma 1.570 0.001
psoriasis -2.100 0.000
osteosarcoma -1.365 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.200 0.002
pancreatic ductal adenocarcinoma liver m... -1.425 0.040
lung cancer -1.200 0.000
interstitial cystitis -1.100 0.001
gastric carcinoma -1.500 0.022
ovarian cancer -2.700 0.000

Gene RIF (8)

PMID Text
21085126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18815128 CHP2 has a role in tumorigenesis and as an activator of the calcineurin/NFAT signaling pathway
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17050540 helix formation of the cytoplasmic region of NHE1 by calcineurin B homologous protein 1 is a prerequisite for generating the active form of NHE1
16511206 crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1
15035633 CHP is important for pH(i)-dependent regulation of Na+/H+ exchanger 1 (NHE1) via tightly bound Ca2+ ions which serve as a crucial structural elements required for this role.
12226101 serum-independent activation of NHE1 by bound CHP2 is one of the key mechanisms for the maintenance of high pH(i) and the resistance to serum deprivation-induced cell death in malignantly transformed cells

AA Sequence

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF      1 - 70
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR     71 - 140
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH                   141 - 195
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21085126 2011 SNPs in axon guidance pathway genes and susceptibility for Parkinson's disease in the Korean population.
20720019 2010 Nuclear-localized calcineurin homologous protein CHP1 interacts with upstream binding factor and inhibits ribosomal RNA synthesis.
More...