Property Summary

NCBI Gene PubMed Count 47
Grant Count 2
Funding $20,613.66
PubMed Score 170.47
PubTator Score 45.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99650 Q6P4E8 Q96QJ6
Symbols OSMRB
PLCA1
IL-31RB
IL-31R-beta

Gene

 Grant Application (2)

Gene RIF (33)

PMID Text
26356818 the RET p.S891A mutation combined with OSMR p.G513D may underlie a novel phenotype manifesting as familial medullary thyroid carcinoma and cutaneous amyloidosis
26311783 OSMRBeta in neurons is critical for neuronal survival during cerebral ischemic/reperfusion.
26198770 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25792357 this study offers new findings on the molecular genetics and disease relevance of mutations in OSMR in Familial primary localized cutaneous amyloidosis.
25283844 The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma.
25054142 primary localized cutaneous amyloidosis has a missense mutation in oncostatin M receptor beta
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of oncostatin M receptor (OSMR) in primary human brain microvascular endothelial cells
24418171 oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells.
24219225 The disease severity of rheumatoid arthritis and systemic lupus erythematosus can be partially affected by the OSMR promoter polymorphisms.
23765377 We conclude that an OSMR/TGM2/integrin-alpha5beta1/fibronectin pathway is of biological significance in cervical squamous cell carcinoma
More...

AA Sequence

MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ      1 - 70
ISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSV     71 - 140
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKG    141 - 210
TNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFES    211 - 280
FSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAI    281 - 350
MTWKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSG    351 - 420
QNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPA    421 - 490
NSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTEGGFSLSWKPQPGDVIGYVVD    491 - 560
WCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACLLEKKTGYSQELAPSDNPH    561 - 630
VLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALI    631 - 700
VDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETC    701 - 770
YPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYL    771 - 840
LPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPA    841 - 910
GETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC     911 - 979
//

Text Mined References (50)

PMID Year Title
26356818 2015 RET mutation p.S891A in a Chinese family with familial medullary thyroid carcinoma and associated cutaneous amyloidosis binding OSMR variant p.G513D.
26311783 2015 Oncostatin M Confers Neuroprotection against Ischemic Stroke.
26198770 2015 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25792357 2015 Familial primary localized cutaneous amyloidosis results from either dominant or recessive mutations in OSMR.
25283844 2015 The interleukin (IL)-31/IL-31R axis contributes to tumor growth in human follicular lymphoma.
25054142 2014 A novel missense mutation in oncostatin M receptor beta causing primary localized cutaneous amyloidosis.
24418171 2014 Characterization of the CD40L/Oncostatin M/Oncostatin M receptor axis as an antiviral and immunostimulatory system disrupted in chronic HCV infection.
24219225 2014 Association of OSMR gene polymorphisms with rheumatoid arthritis and systemic lupus erythematosus patients.
23765377 2013 Tissue transglutaminase mediates the pro-malignant effects of oncostatin M receptor over-expression in cervical squamous cell carcinoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...