Property Summary

NCBI Gene PubMed Count 51
PubMed Score 178.80
PubTator Score 45.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Primary cutaneous amyloidosis 29 0.0 5.0

Expression

  Differential Expression (33)

Disease log2 FC p
acute quadriplegic myopathy 1.028 4.4e-05
adult high grade glioma 1.100 3.1e-02
aldosterone-producing adenoma -1.314 4.0e-02
Astrocytoma, Pilocytic 1.300 1.3e-04
atypical teratoid / rhabdoid tumor 1.400 5.0e-02
diabetes mellitus -1.600 2.1e-02
ependymoma 1.700 7.4e-06
gastric carcinoma 2.000 8.1e-03
Gaucher disease type 1 -1.200 3.7e-02
glioblastoma 1.200 2.7e-03
group 3 medulloblastoma -1.200 4.8e-02
head and neck cancer 1.700 1.4e-04
interstitial cystitis 1.300 2.0e-02
intraductal papillary-mucinous adenoma (... -1.500 1.6e-02
juvenile dermatomyositis 1.334 1.5e-11
limb girdle muscular dystrophy 2B 1.033 4.0e-04
lung adenocarcinoma 1.400 6.5e-06
lung cancer -1.700 9.5e-03
lung carcinoma -3.400 6.5e-32
medulloblastoma, large-cell -2.100 3.5e-04
mucosa-associated lymphoid tissue lympho... 1.408 2.8e-02
non diabetic and post-ischemic heart fai... -1.500 5.1e-03
non-small cell lung cancer 1.828 7.3e-15
osteosarcoma 1.209 2.7e-03
ovarian cancer -2.500 2.9e-07
pancreatic cancer 2.400 8.5e-04
pituitary cancer -1.100 1.6e-03
primary pancreatic ductal adenocarcinoma 2.393 2.7e-04
psoriasis 1.400 3.8e-06
sarcoidosis -1.200 2.7e-02
spina bifida -1.115 2.7e-02
subependymal giant cell astrocytoma 1.730 2.5e-02
ulcerative colitis 2.100 1.0e-05

Protein-protein Interaction (2)

Gene RIF (37)

AA Sequence

MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ      1 - 70
ISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSV     71 - 140
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKG    141 - 210
TNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFES    211 - 280
FSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAI    281 - 350
MTWKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSG    351 - 420
QNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPA    421 - 490
NSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTEGGFSLSWKPQPGDVIGYVVD    491 - 560
WCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACLLEKKTGYSQELAPSDNPH    561 - 630
VLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALI    631 - 700
VDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETC    701 - 770
YPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYL    771 - 840
LPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPA    841 - 910
GETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC     911 - 979
//

Text Mined References (54)

PMID Year Title