Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
Funding $1,407,796.01
PubMed Score 17.19
PubTator Score 13.53

Knowledge Summary

Patent (14,407)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis 1.500 0.000
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer 1.016 0.000
breast carcinoma 2.200 0.000
lung adenocarcinoma 1.600 0.000
inflammatory breast cancer 3.100 0.000

Synonym

Accession Q99640 B3KUN8 B4DXD4 D3DUA4 F8W164 I3L1V2 O14731 Q7LE24 Q8TCM9
Symbols MYT1
PPP1R126

Gene

PDB

3P1A  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
23241949 Myt1 is inactivated by MEK1 mediated phosphorylation to fragment the Golgi complex in G2 and for the entry of cells into mitosis.
18378775 The results show that Myt1-mediated suppression of Cdc2 activity is not indispensable for the regulation of a broad range of mitotic events but is specifically required for the control of intracellular membrane dynamics during mitosis in Hela cells.
16476973 overexpressed during the S phase of the cell cycle compared with the G0/1 phase
15175024 the induction of Cdc2 phosphorylation due to the increase of Wee1 and Myt1 as well as the reduction of Cdc2 and cyclin B1 are involved in 1,25[OH]2VD3-induced G2/M arrest of keratinocytes.
12738781 Myt1 is phosphorylated by polo-like kinase 1
12606722 MYT1 binds to TSAP6 in tumor cells and has a role in cell cycle regulation

AA Sequence

MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPR      1 - 70
TPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKR     71 - 140
SMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQV    141 - 210
WGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQ    211 - 280
GSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA    281 - 350
EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS    351 - 420
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLS    421 - 490
LFEDTLDPT                                                                 491 - 499
//

Text Mined References (33)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23241949 2013 MEK1 inactivates Myt1 to regulate Golgi membrane fragmentation and mitotic entry in mammalian cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22189141 2012 In vitro and in silico studies on substrate recognition and acceptance of human PKMYT1, a Cdk1 inhibitory kinase.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...