Property Summary

NCBI Gene PubMed Count 95
PubMed Score 141.00
PubTator Score 106.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Neoplasms, Second Primary 6 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.8e-09
malignant mesothelioma 3232 9.9e-08
Disease Target Count Z-score Confidence
Cancer 2499 3.345 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.700 9.9e-08
osteosarcoma 2.266 1.8e-09

Protein-protein Interaction (2)

Gene RIF (61)

AA Sequence

MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQDL      1 - 70
LRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPAS     71 - 140
CPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCLGEEDFQQLQAQ    141 - 210
EGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPER    211 - 280
HQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPS    281 - 350
TVPGTPPPKKFRSLFFGSILAPVRSPQGPSPVLAEDSEGEG                                 351 - 391
//

Text Mined References (104)

PMID Year Title