Property Summary

NCBI Gene PubMed Count 94
Grant Count 216
R01 Count 176
Funding $15,461,480.32
PubMed Score 136.30
PubTator Score 106.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
osteosarcoma 2.266 0.000

Synonym

Accession Q99638 B2RCZ8 Q6FI29 Q96C41 hRAD9
Symbols RAD9

Gene

PDB

3A1J   3G65   3GGR  

Gene RIF (61)

PMID Text
26860083 TLK1B mediated phosphorylation of Rad9 regulates its nuclear/cytoplasmic localization and cell cycle checkpoint
26667770 RAD9 has a prominent role in the ATR-Chk1 pathway that is necessary for successful formation of the damage-sensing complex and DNA damage checkpoint signaling.
26658951 these results demonstrate a positive feedback loop involving Rad9A-dependend activation of Chk1.
26088138 Intramolecular binding of the rad9 C-terminus in the checkpoint clamp Rad9-Hus1-Rad1 is closely linked with its DNA binding.
25485590 The role of Rad9 in homologous recombination is independent of its function in checkpoint activation, and this function is important for preventing alternative non-homologous end joining.
25234738 we found that H1299 cells with reduced RAD9 protein levels showed a higher frequency of radiation induced bystander micronuclei formation
25127721 These data reveal that human Rad9 interacts directly with N-terminal region of human MYH.
25111005 Downregulation of RAD9 when combined with ionizing radiation results in reduction of ITGB1 protein levels in prostate cancer cells, and increased lethality.
24971543 These data suggest that v-Src attenuates ATR-Chk1 signaling through the inhibition of Rad17-Rad9 interaction.
24403312 Loss of hrad9 expression is associated with breast and lung cancer.
More...

AA Sequence

MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQDL      1 - 70
LRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPAS     71 - 140
CPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCLGEEDFQQLQAQ    141 - 210
EGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPER    211 - 280
HQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPS    281 - 350
TVPGTPPPKKFRSLFFGSILAPVRSPQGPSPVLAEDSEGEG                                 351 - 391
//

Text Mined References (103)

PMID Year Title
26860083 2016 TLK1B mediated phosphorylation of Rad9 regulates its nuclear/cytoplasmic localization and cell cycle checkpoint.
26667770 2015 Regulation of ATRIP protein abundance by RAD9 in the DNA damage repair pathway.
26658951 2015 Chk1 Activation Protects Rad9A from Degradation as Part of a Positive Feedback Loop during Checkpoint Signalling.
26088138 2015 Intramolecular Binding of the Rad9 C Terminus in the Checkpoint Clamp Rad9-Hus1-Rad1 Is Closely Linked with Its DNA Binding.
25485590 2014 The checkpoint clamp protein Rad9 facilitates DNA-end resection and prevents alternative non-homologous end joining.
25234738 2014 RAD9 deficiency enhances radiation induced bystander DNA damage and transcriptomal response.
25127721 2014 Visualization of the physical and functional interaction between hMYH and hRad9 by Dronpa bimolecular fluorescence complementation.
25111005 2014 RAD9 enhances radioresistance of human prostate cancer cells through regulation of ITGB1 protein levels.
24971543 2014 v-Src inhibits the interaction between Rad17 and Rad9 and induces replication fork collapse.
24403312 2014 hRAD9 functions as a tumor suppressor by inducing p21-dependent senescence and suppressing epithelial-mesenchymal transition through inhibition of Slug transcription.
More...