Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $736,995
PubMed Score 19.23
PubTator Score 9.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.004

Gene RIF (3)

PMID Text
22213562 Presented is solution structure of the splicing factor motif of hPrp18, which forms a compact fold with two a helices interacting head-to-tail and a fixed linker loop.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLTSSNPVLELEL      1 - 70
AEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLN     71 - 140
EIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYV    141 - 210
KRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWP    211 - 280
IGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL            281 - 342
//

Text Mined References (14)

PMID Year Title
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22213562 2012 Solution structure of the splicing factor motif of the human Prp18 protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...