Property Summary

NCBI Gene PubMed Count 12
PubMed Score 19.23
PubTator Score 9.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00374559272115271

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.004

Synonym

Accession Q99633 Q5T9P9 Q9BUI9
Symbols PRP18
hPrp18

Gene

PDB

2DK4  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (3)

PMID Text
22213562 Presented is solution structure of the splicing factor motif of hPrp18, which forms a compact fold with two a helices interacting head-to-tail and a fixed linker loop.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLTSSNPVLELEL      1 - 70
AEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLN     71 - 140
EIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYV    141 - 210
KRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWP    211 - 280
IGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL            281 - 342
//

Text Mined References (14)

PMID Year Title
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22213562 2012 Solution structure of the splicing factor motif of the human Prp18 protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...