Property Summary

NCBI Gene PubMed Count 34
Grant Count 10
R01 Count 9
Funding $1,113,315.7
PubMed Score 14.96
PubTator Score 92.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma -2.000 0.023
ependymoma -1.600 0.023
oligodendroglioma -1.300 0.027
osteosarcoma 2.641 0.000
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.019
acute quadriplegic myopathy 1.122 0.000
lung cancer 1.700 0.000
adult high grade glioma -1.500 0.001
pilocytic astrocytoma -1.200 0.000
Alzheimer's disease -1.200 0.031
Pick disease -1.200 0.000
ovarian cancer -1.600 0.000
pancreatic cancer 1.100 0.029

Gene RIF (8)

PMID Text
23689509 Data indicate that silencing of Csn8 caused an increased growth rate, whereas silencing of Csn5 impaired proliferation in HeLa cells.
22992343 miR-146a expression is up-regulated in a majority of gastric cancers where it targets CARD10 and COPS8, inhibiting GPCR-mediated activation of NF-kappaB.
22414063 proteomic-based approach can broaden our understanding of the functions of the CSN in contexts such as viral-host interactions or immune activation in their natural milieu
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 8 (COPS8; CSN8) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20399188 analysis of the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3
18424433 COP9/signalosome increases the efficiency of von Hippel-Lindau protein ubiquitin ligase-mediated hypoxia-inducible factor-alpha ubiquitination
17318178 The COP9 signalosome (CSN) controls NF-kappaB by deubiquitinylation of IkappaBalpha.
12732143 DDB2 and CSA are each integrated into nearly identical complexes via interaction with DDB1. Both complexes contain cullin 4A and Roc1 and display ubiquitin ligase activity. They also contain the COP9 signalosome (CSN)

AA Sequence

MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSE      1 - 70
LGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLP     71 - 140
VEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN     141 - 209
//

Text Mined References (41)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23689509 2013 COP9 signalosome subunit Csn8 is involved in maintaining proper duration of the G1 phase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22992343 2012 microRNA-146a inhibits G protein-coupled receptor-mediated activation of NF-?B by targeting CARD10 and COPS8 in gastric cancer.
22414063 2012 Purification of the COP9 signalosome complex and binding partners from human T cells.
21269460 2011 Initial characterization of the human central proteome.
20399188 2010 Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3.
More...