Property Summary

NCBI Gene PubMed Count 34
PubMed Score 14.96
PubTator Score 92.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.100 5.2e-06
astrocytic glioma -2.000 2.3e-02
ependymoma -1.600 2.3e-02
oligodendroglioma -1.300 2.7e-02
osteosarcoma 2.641 1.4e-05
glioblastoma -2.000 7.9e-06
atypical teratoid / rhabdoid tumor -2.300 8.5e-08
medulloblastoma -1.400 6.8e-05
medulloblastoma, large-cell -1.900 1.7e-05
primitive neuroectodermal tumor -1.100 1.9e-02
acute quadriplegic myopathy 1.122 5.8e-05
lung cancer 1.700 1.0e-04
adult high grade glioma -1.500 1.1e-03
pilocytic astrocytoma -1.200 2.1e-04
Alzheimer's disease -1.200 3.1e-02
Pick disease -1.200 4.6e-04
ovarian cancer -1.600 3.0e-07
pancreatic cancer 1.100 2.9e-02

Gene RIF (8)

PMID Text
23689509 Data indicate that silencing of Csn8 caused an increased growth rate, whereas silencing of Csn5 impaired proliferation in HeLa cells.
22992343 miR-146a expression is up-regulated in a majority of gastric cancers where it targets CARD10 and COPS8, inhibiting GPCR-mediated activation of NF-kappaB.
22414063 proteomic-based approach can broaden our understanding of the functions of the CSN in contexts such as viral-host interactions or immune activation in their natural milieu
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 8 (COPS8; CSN8) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20399188 analysis of the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3
18424433 COP9/signalosome increases the efficiency of von Hippel-Lindau protein ubiquitin ligase-mediated hypoxia-inducible factor-alpha ubiquitination
17318178 The COP9 signalosome (CSN) controls NF-kappaB by deubiquitinylation of IkappaBalpha.
12732143 DDB2 and CSA are each integrated into nearly identical complexes via interaction with DDB1. Both complexes contain cullin 4A and Roc1 and display ubiquitin ligase activity. They also contain the COP9 signalosome (CSN)

AA Sequence

MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSE      1 - 70
LGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLP     71 - 140
VEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN     141 - 209
//

Text Mined References (41)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23689509 2013 COP9 signalosome subunit Csn8 is involved in maintaining proper duration of the G1 phase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22992343 2012 microRNA-146a inhibits G protein-coupled receptor-mediated activation of NF-?B by targeting CARD10 and COPS8 in gastric cancer.
22414063 2012 Purification of the COP9 signalosome complex and binding partners from human T cells.
21269460 2011 Initial characterization of the human central proteome.
20399188 2010 Structural insights into the COP9 signalosome and its common architecture with the 26S proteasome lid and eIF3.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18424433 2008 The COP9/signalosome increases the efficiency of von Hippel-Lindau protein ubiquitin ligase-mediated hypoxia-inducible factor-alpha ubiquitination.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17318178 2007 CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304329 2004 Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647295 2003 The COP9 signalosome: an assembly and maintenance platform for cullin ubiquitin ligases?
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12628923 2003 Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.
12615944 2003 Characterization of the last subunit of the Arabidopsis COP9 signalosome: implications for the overall structure and origin of the complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324474 2002 Inositol 1,3,4-trisphosphate 5/6-kinase associates with the COP9 signalosome by binding to CSN1.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
11567875 2001 COP9 signalosome revisited: a novel mediator of protein degradation.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11285227 2001 COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.
11032325 2000 Human COP9 subunit 8 homolog gene SGN8 Map position 2q37.
10991940 2000 Interaction between interferon consensus sequence-binding protein and COP9/signalosome subunit CSN2 (Trip15). A possible link between interferon regulatory factor signaling and the COP9/signalosome.
10585392 1999 COP9 signalosome-directed c-Jun activation/stabilization is independent of JNK.
9707402 1998 The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex.
9535219 1998 A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8689678 1996 The COP9 complex, a novel multisubunit nuclear regulator involved in light control of a plant developmental switch.
7634324 1995 The novel components of the Arabidopsis light signaling pathway may define a group of general developmental regulators shared by both animal and plant kingdoms.