Property Summary

NCBI Gene PubMed Count 256
Grant Count 203
R01 Count 108
Funding $22,685,921.79
PubMed Score 784.90
PubTator Score 618.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ulcerative colitis -1.500 0.000
psoriasis 2.500 0.000

Synonym

Accession Q99626 O00503 Q5VTU7 Q969L8 Q9UD92
Symbols CDX3
CDX-3
CDX2/AS

Gene

Gene RIF (241)

PMID Text
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26902420 Results point out the complex interplay between the DSB DNA repair activity and the homeoproteins HoxB7 and Cdx2 in colon cancer cells.
26841784 Changes in CDX1/CDX2 mRNA expression in gastric mucosa following H. pylori eradication showed only insignificant results
26789870 Lack of CDX2 expression identified a subgroup of patients with high-risk stage II colon cancer who appeared to benefit from adjuvant chemotherapy.
26772394 We conclude that CDX2 is a sensitive and relatively specific marker for yolk sac tumor among the nonteratomatous germ cell testicular tumors
26759244 findings illuminated a role for NOD1 signaling in attenuating H. pylori-induced Cdx2 expression in gastric epithelial cells
26743476 Suggest that NKX6.3 might function as a master regulator of gastric differentiation by affecting SOX2 and CDX2 expression and the NKX6.3 inactivation may result in intestinal metaplasia in gastric epithelial cells.
26551082 that CDX2 downregulation is associated with mismatch repair deficiency, right-sided tumors, and poor differentiation at both the mRNA and protein level
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26346470 Daily intake of vitamin D-FD for 12 weeks improved the central obesity indices in T2D subjects, and the improvement was more pronounced in the carriers of the AA genotype of VDR-Cdx-2.
More...

AA Sequence

MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYG      1 - 70
APLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTL     71 - 140
NPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY    141 - 210
ITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE    211 - 280
PLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ                                         281 - 313
//

Text Mined References (258)

PMID Year Title
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26902420 2016 Distinct mechanisms for opposite functions of homeoproteins Cdx2 and HoxB7 in double-strand break DNA repair in colon cancer cells.
26841784 2016 Follow-Up Study on CDX1 and CDX2 mRNA Expression in Noncancerous Gastric Mucosae After Helicobacter pylori Eradication.
26789870 2016 CDX2 as a Prognostic Biomarker in Stage II and Stage III Colon Cancer.
26772394 2016 The utility of CDX2, GATA3, and DOG1 in the diagnosis of testicular neoplasms: an immunohistochemical study of 109 cases.
26759244 2016 Cdx2 Expression and Intestinal Metaplasia Induced by H. pylori Infection of Gastric Cells Is Regulated by NOD1-Mediated Innate Immune Responses.
26743476 2016 Inactivation of NKX6.3 in the stomach leads to abnormal expression of CDX2 and SOX2 required for gastric-to-intestinal transdifferentiation.
26551082 2016 CDX2 downregulation is associated with poor differentiation and MMR deficiency in colon cancer.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26346470 2015 Vitamin D receptor Cdx-2-dependent response of central obesity to vitamin D intake in the subjects with type 2 diabetes: a randomised clinical trial.
More...