Property Summary

NCBI Gene PubMed Count 276
PubMed Score 837.01
PubTator Score 618.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
active ulcerative colitis -1.163 3.3e-02
psoriasis 2.500 6.5e-09

 GWAS Trait (1)

Gene RIF (259)

AA Sequence

MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYG      1 - 70
APLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTL     71 - 140
NPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY    141 - 210
ITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE    211 - 280
PLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ                                         281 - 313
//

Text Mined References (278)

PMID Year Title