Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.07
PubTator Score 7.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 0.000
pituitary cancer 1.200 0.003

Gene RIF (1)

PMID Text
19609018 Shows that this gene is associated with the regulation of cell proliferation in canine mammary cancer cell lines.

AA Sequence

MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP      1 - 70
VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL     71 - 140
YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC    141 - 210
QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ                     211 - 263
//

Text Mined References (16)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20561531 2010 Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4.
19609018 2009 Transcriptomic profile of two canine mammary cancer cell lines with different proliferative and anti-apoptotic potential.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16541075 2006 The finished DNA sequence of human chromosome 12.
16498413 2006 Structural and functional insights into the B30.2/SPRY domain.
15713673 2005 The SPRY domain-containing SOCS box protein 1 (SSB-1) interacts with MET and enhances the hepatocyte growth factor-induced Erk-Elk-1-serum response element pathway.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
More...