Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.41
PubTator Score 7.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.3e-05
pituitary cancer 1972 3.0e-03
Disease Target Count Z-score Confidence
Borderline personality disorder 11 3.807 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 3.3e-05
pituitary cancer 1.200 3.0e-03

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (2)

AA Sequence

MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP      1 - 70
VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL     71 - 140
YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC    141 - 210
QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ                     211 - 263
//

Text Mined References (17)

PMID Year Title