Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.68
PubTator Score 7.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25673160 OY-TES-1 downregulation in liver cancer cells promotes cell proliferation by upregulating CCND2 and CDCA3.
25236463 High CDCA3 expression is associated with neoplasms.
23219899 HoxB3 promote prostate cancer progression by upregulating CDCA3 expression.
22839099 overexpression of CDCA3 occurs frequently during oral carcinogenesis.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15733861 a repressor element (cell-cycle-dependent element/cell cycle gene homology region) in the vicinity of the transcription start site, and mutations within this element diminished the cell-cycle-dependent transcriptional regulation of Tome-1

AA Sequence

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT      1 - 70
LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN     71 - 140
QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP    141 - 210
GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES                211 - 268
//

Text Mined References (24)

PMID Year Title
25673160 2015 OY-TES-1 may regulate the malignant behavior of liver cancer via NANOG, CD9, CCND2 and CDCA3: a bioinformatic analysis combine with RNAi and oligonucleotide microarray.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25236463 2015 Translating bioinformatics in oncology: guilt-by-profiling analysis and identification of KIF18B and CDCA3 as novel driver genes in carcinogenesis.
23219899 2013 HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22839099 2012 Overexpression of cell cycle regulator CDCA3 promotes oral cancer progression by enhancing cell proliferation with prevention of G1 phase arrest.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...