Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.16
PubTator Score 7.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma 1.010 1.4e-02
adult high grade glioma 1.200 1.8e-03
Atopic dermatitis 1.500 2.4e-04
atypical teratoid / rhabdoid tumor 2.100 5.9e-10
Breast cancer 1.200 1.1e-09
breast carcinoma 1.200 2.3e-30
ductal carcinoma in situ 1.400 5.5e-03
Endometriosis 1.166 1.5e-02
ependymoma 1.200 7.8e-07
glioblastoma 1.600 2.1e-08
group 3 medulloblastoma 1.600 2.9e-04
intraductal papillary-mucinous carcinoma... 2.500 6.6e-05
intraductal papillary-mucinous neoplasm ... 3.200 2.7e-04
invasive ductal carcinoma 1.100 8.3e-04
lung adenocarcinoma 1.200 3.9e-11
lung cancer 1.800 4.1e-05
malignant mesothelioma 1.200 2.2e-06
medulloblastoma, large-cell 2.000 1.4e-05
non-small cell lung cancer 2.261 8.5e-26
osteosarcoma -1.280 3.9e-02
ovarian cancer 1.500 2.4e-10
pancreatic cancer 1.200 1.1e-03
primitive neuroectodermal tumor 1.900 3.7e-06
psoriasis 1.200 2.2e-61

Gene RIF (6)

AA Sequence

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT      1 - 70
LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN     71 - 140
QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP    141 - 210
GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES                211 - 268
//

Text Mined References (24)

PMID Year Title