Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.68
PubTator Score 7.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.1524055948324E-61
breast carcinoma 1614 2.28912576376831E-30
non-small cell lung cancer 2798 1.28452793002639E-29
Breast cancer 3099 3.7191429971358E-18
atypical teratoid/rhabdoid tumor 1095 1.49291788301366E-11
lung adenocarcinoma 2714 3.87741463839552E-11
glioblastoma 5572 1.79721151405381E-10
sonic hedgehog group medulloblastoma 1482 3.79799119816176E-9
ovarian cancer 8492 2.56093194339421E-7
pediatric high grade glioma 2712 2.89056851718452E-7
malignant mesothelioma 3163 2.16571789878873E-6
primitive neuroectodermal tumor 3031 5.5107250555875E-6
posterior fossa group A ependymoma 1511 5.97720907353675E-6
medulloblastoma, large-cell 6234 1.409183696156E-5
lung cancer 4473 4.08458919643802E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.62480583301668E-5
invasive ductal carcinoma 2950 1.26561575234646E-4
Atopic dermatitis 944 2.4441508974735E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.72053943647587E-4
pancreatic cancer 2300 0.00108579203856518
adrenocortical carcinoma 1427 0.00158445240538406
ductal carcinoma in situ 1745 0.00552744994900722
Endometriosis 535 0.0114232584166411
osteosarcoma 7933 0.0385888453404872
Disease Target Count Z-score Confidence
Clonorchiasis 15 3.51 1.8
Factor XI deficiency 9 3.105 1.6

Expression

Synonym

Accession Q99618 A8K5V6 D3DUS6
Symbols GRCC8
TOME-1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (6)

PMID Text
25673160 OY-TES-1 downregulation in liver cancer cells promotes cell proliferation by upregulating CCND2 and CDCA3.
25236463 High CDCA3 expression is associated with neoplasms.
23219899 HoxB3 promote prostate cancer progression by upregulating CDCA3 expression.
22839099 overexpression of CDCA3 occurs frequently during oral carcinogenesis.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15733861 a repressor element (cell-cycle-dependent element/cell cycle gene homology region) in the vicinity of the transcription start site, and mutations within this element diminished the cell-cycle-dependent transcriptional regulation of Tome-1

AA Sequence

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT      1 - 70
LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN     71 - 140
QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP    141 - 210
GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES                211 - 268
//

Text Mined References (24)

PMID Year Title
25673160 2015 OY-TES-1 may regulate the malignant behavior of liver cancer via NANOG, CD9, CCND2 and CDCA3: a bioinformatic analysis combine with RNAi and oligonucleotide microarray.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25236463 2015 Translating bioinformatics in oncology: guilt-by-profiling analysis and identification of KIF18B and CDCA3 as novel driver genes in carcinogenesis.
23219899 2013 HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22839099 2012 Overexpression of cell cycle regulator CDCA3 promotes oral cancer progression by enhancing cell proliferation with prevention of G1 phase arrest.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...