Property Summary

NCBI Gene PubMed Count 50
Grant Count 10
R01 Count 10
Funding $615,007.54
PubMed Score 92.93
PubTator Score 84.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.310 0.001
colon cancer -1.500 0.002
lung cancer -2.700 0.000
breast carcinoma -1.100 0.023
interstitial cystitis 2.300 0.000
psoriasis 1.100 0.001

Gene RIF (28)

PMID Text
25654294 CCL13 levels in serum and synovial fluid may serve as a biomarker for the progression of osteoarthritis.
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
23846739 Data suggest that CCL13 binds to several chemokine receptors (CCR1, CCR2, and CCR3), allowing CCL13 to elicit different effects on target cells of immune system. CCL13 is involved in pathology of chronic inflammatory/autoimmune diseases. [REVIEW]
23375121 MCP-4 and hsCRP may be the markers linking chronic inflammation in obesity and periodontal disease.
22393877 E(2) has adverse effects on the pathogenesis of RA as a result of unregulated cell death, increased TNF-alpha-induced MMP-3 production, and CCL13 overproduction, subsequently resulting in the disease progression of RA.
21327296 Data show that, for the small macrophages in COPD, increased transcript and protein levels for CCL2, CCL7, CCL13 and CCL22 with a more than 100-fold increase for CCL13 mRNA.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLG      1 - 70
KEICADPKEKWVQNYMKHLGRKAHTLKT                                               71 - 98
//

Text Mined References (51)

PMID Year Title
25654294 2015 Association of CCL13 levels in serum and synovial fluid with the radiographic severity of knee osteoarthritis.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
23846739 2013 The multiple faces of CCL13 in immunity and inflammation.
23375121 2013 Correlation of MCP-4 and high-sensitivity C-reactive protein as a marker of inflammation in obesity and chronic periodontitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22393877 2012 Estrogen inhibits apoptosis and promotes CC motif chemokine ligand 13 expression on synovial fibroblasts in rheumatoid arthritis.
21327296 2011 Chemokine expression by small sputum macrophages in COPD.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
More...