Property Summary

NCBI Gene PubMed Count 53
PubMed Score 99.20
PubTator Score 84.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 3.1e-05
psoriasis 6694 7.6e-04
osteosarcoma 7950 1.0e-03
colon cancer 1478 2.4e-03
interstitial cystitis 2312 6.4e-03
breast carcinoma 1638 2.3e-02
Disease Target Count Z-score Confidence
Asthma 385 3.681 1.8
Atopic dermatitis 952 3.095 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.100 2.3e-02
colon cancer -1.500 2.4e-03
interstitial cystitis 2.100 6.4e-03
lung cancer -2.700 3.1e-05
osteosarcoma -1.310 1.0e-03
psoriasis 1.100 7.6e-04

Gene RIF (31)

AA Sequence

MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLG      1 - 70
KEICADPKEKWVQNYMKHLGRKAHTLKT                                               71 - 98
//

Text Mined References (54)

PMID Year Title