Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.94
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 1.1e-03
atypical teratoid / rhabdoid tumor -1.100 3.6e-04
glioblastoma -1.300 1.7e-03
group 3 medulloblastoma 1.100 2.3e-02
intraductal papillary-mucinous adenoma (... 1.100 2.0e-02
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
lung adenocarcinoma 1.003 3.1e-05
lung cancer 1.100 6.1e-04
non primary Sjogren syndrome sicca -1.200 5.0e-03
ovarian cancer -2.100 7.7e-16
psoriasis -1.300 1.3e-04
Rheumatoid arthritis 1.700 2.6e-02
Waldenstrons macroglobulinemia 1.014 4.2e-03

Gene RIF (8)

AA Sequence

MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAA      1 - 70
TLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNAN     71 - 140
AVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNA    141 - 210
DALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYT    211 - 280
EALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRD    281 - 350
YEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV    351 - 420
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFF    421 - 490
FQFG                                                                      491 - 494
//

Text Mined References (31)

PMID Year Title