Property Summary

NCBI Gene PubMed Count 21
Grant Count 10
R01 Count 7
Funding $1,067,795.47
PubMed Score 13.93
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24789201 ubiquitin-proteasomal regulation of CCRP and HSP70 are important contributors to the regulation of cytoplasmic CAR levels, and hence the ability of CAR to respond to PB or PB-like inducers
23261415 these findings strongly suggest that DnaJC7 participates in p53/MDM2 negative feedback regulatory pathway, and thereby enhancing the stability and activity of p53.
22944692 HIV-1 Vif is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily C, member 7 (DNAJC7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Vif is identified to have a physical interaction with DnaJ (Hsp40) homolog, subfamily C, member 7 (DNAJC7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20661446 TPR2 exhibited strong interaction with glucocorticoid receptor and progesterone receptors.
18620420 Data show that Tpr2 associates with Hsp90 and Hsp70 complexes, promoted the accumulation of Hsp70 in PR heterocomplexes in the presence of Hsp90. Thus, Tpr2 has the potential to regulate PR chaperoning.
12853476 TPR2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.

AA Sequence

MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAA      1 - 70
TLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNAN     71 - 140
AVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNA    141 - 210
DALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYT    211 - 280
EALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRD    281 - 350
YEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV    351 - 420
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFF    421 - 490
FQFG                                                                      491 - 494
//

Text Mined References (30)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24789201 2014 Coordinated regulation of nuclear receptor CAR by CCRP/DNAJC7, HSP70 and the ubiquitin-proteasome system.
23261415 2013 Co-chaperon DnaJC7/TPR2 enhances p53 stability and activity through blocking the complex formation between p53 and MDM2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20661446 2010 Differential impact of tetratricopeptide repeat proteins on the steroid hormone receptors.
19946888 2010 Defining the membrane proteome of NK cells.
More...