Property Summary

NCBI Gene PubMed Count 20
PubMed Score 32.31
PubTator Score 25.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.300 7.8e-03
ovarian cancer 1.300 5.6e-06

Gene RIF (5)

AA Sequence

MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASF      1 - 70
EEEPGADKVENKSNEDVNSSELDEEYLIELEKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYS     71 - 140
RALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALE    141 - 210
DYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSY    211 - 280
SINFVQNPNNNR                                                              281 - 292
//

Text Mined References (27)

PMID Year Title