Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
R01 Count 3
Funding $118,780.24
PubMed Score 30.82
PubTator Score 25.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.300 0.008
ovarian cancer 1.300 0.000

Synonym

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
23067341 The crystal structure of monopolar spindle 1 (Mps1) N-terminal region TPR domain has been determined.
22711498 TPR1 is required for Galpha14 to stimulate Ras-dependent signaling pathways, but not for the propagation of signals along Ras-independent pathways.
21486497 beta3 region of Galpha16 is essential for interaction with TPR1 and the subsequent activation of Ras
14503850 Results report cooperative interactions involving Hsp70, Hsp40, and TPR1 that enhance Hsp70-dependent folding of chemically denatured substrates.
12748287 Data show that tetratricopeptide repeat 1 is a novel adaptor protein for Ras and selected Galpha proteins that may be involved in protein-protein interaction relating to G-protein signaling.

AA Sequence

MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASF      1 - 70
EEEPGADKVENKSNEDVNSSELDEEYLIELEKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYS     71 - 140
RALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALE    141 - 210
DYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSY    211 - 280
SINFVQNPNNNR                                                              281 - 292
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23067341 2012 Structural and functional insights into the role of the N-terminal Mps1 TPR domain in the SAC (spindle assembly checkpoint).
22711498 2012 Activation of Ras-dependent signaling pathways by G(14) -coupled receptors requires the adaptor protein TPR1.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21486497 2011 G?16 interacts with tetratricopeptide repeat 1 (TPR1) through its ?3 region to activate Ras independently of phospholipase C? signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...