Property Summary

NCBI Gene PubMed Count 36
PubMed Score 12.94
PubTator Score 8.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (7)

PMID Text
25823503 These findings suggest that eIF3c is overexpressed in human gliomas and essential for their proliferation and survival.
24912683 eIF3a and eIF3c control abundance and assembly of the entire eIF3 and thus represent its crucial scaffolding elements critically required for formation of preinitiation complexes.
24092755 eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23733421 Collectively, eIF3c deletion effectively reduced the survival of colon cancer cells and could be used as a therapeutic tool for colon cancer therapy.
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit C (EIF3C) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit C (EIF3C) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22016036 These results indicate that the interaction between Hsp90 and eIF3c may play an important role in hepatitis C virus internal ribosome entry site-mediated translation.

AA Sequence

MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNA      1 - 70
MKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALST     71 - 140
LRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRK    141 - 210
FLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKK    211 - 280
KHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQ    281 - 350
IELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFV    351 - 420
GENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYL    421 - 490
EEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDR    491 - 560
TDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAH    561 - 630
NALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAA    631 - 700
HESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFP    701 - 770
EADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQ    771 - 840
TVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQSQ    841 - 910
TAY                                                                       911 - 913
//

Text Mined References (48)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25823503 2015 Eukaryotic initiation factor 3C silencing inhibits cell proliferation and promotes apoptosis in human glioma.
24912683 2014 Functional and biochemical characterization of human eukaryotic translation initiation factor 3 in living cells.
24092755 2013 Human eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23733421 2013 Effect of siRNA-mediated knockdown of eIF3c gene on survival of colon cancer cells.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...