Property Summary

NCBI Gene PubMed Count 11
PubMed Score 22.86
PubTator Score 12.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 7.30665137564811E-8
osteosarcoma 7933 7.27375620831508E-6
invasive ductal carcinoma 2950 0.00104475430701425
lung cancer 4473 0.00106173593199156
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00244093331164944
ovarian cancer 8492 0.00274311989199017
Waldenstrons macroglobulinemia 765 0.00343334566498552
non-inflammatory breast cancer 208 0.00931855153947458
esophageal adenocarcinoma 737 0.0179823412109931
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0263366211835409
astrocytic glioma 2241 0.0418961377399928

Expression

Synonym

Accession Q99611 Q9BUQ2
Symbols SPS2
SPS2b

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (2)

PMID Text
23934683 miR-185 plays a role in up-regulation of GPX2 and SEPHS2 expression.In the case of SEPHS2 this may contribute to maintaining selenoprotein synthesis.
15534230 the Sps1-encoded enzyme depends on a selenium salvage system that recycles l-selenocysteine, whereas the Sps2 enzyme can function with a selenite assimilation system

AA Sequence

MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKGUGCKVPQEALL      1 - 70
KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFF     71 - 140
YPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAV    141 - 210
TGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVS    211 - 280
REEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKM    281 - 350
AAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKP    351 - 420
RVIEVLPRGATAAVLAPDSSNASSEPSS                                              421 - 448
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23934683 2013 Selenium alters miRNA profile in an intestinal cell line: evidence that miR-185 regulates expression of GPX2 and SEPSH2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17916946 2007 New developments in selenium biochemistry: selenocysteine biosynthesis in eukaryotes and archaea.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15791204 2005 Recoding elements located adjacent to a subset of eukaryal selenocysteine-specifying UGA codons.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15534230 2004 Selenophosphate synthetase genes from lung adenocarcinoma cells: Sps1 for recycling L-selenocysteine and Sps2 for selenite assimilation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...