Property Summary

NCBI Gene PubMed Count 13
PubMed Score 25.30
PubTator Score 12.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 4.2e-02
esophageal adenocarcinoma 1.400 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-03
invasive ductal carcinoma 1.500 1.0e-03
lung cancer 1.100 1.1e-03
non-inflammatory breast cancer 1.200 9.3e-03
osteosarcoma -1.458 7.3e-06
ovarian cancer 1.400 2.7e-03
pancreatic ductal adenocarcinoma liver m... -1.168 2.6e-02
ulcerative colitis -1.300 7.3e-08
Waldenstrons macroglobulinemia 1.165 3.4e-03

Gene RIF (3)

AA Sequence

MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKGUGCKVPQEALL      1 - 70
KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFF     71 - 140
YPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAV    141 - 210
TGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVS    211 - 280
REEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKM    281 - 350
AAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKP    351 - 420
RVIEVLPRGATAAVLAPDSSNASSEPSS                                              421 - 448
//

Text Mined References (16)

PMID Year Title