1. Home
  2. Targets
  3. cell adhesion molecule
  4. DNA binding protein
  5. Necdin

Tbio Necdin

Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences (By similarity).

This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 43
PubMed Score 160.94
PubTator Score 58.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Animal Mammary Neoplasms 136
Disease Target Count P-value
breast carcinoma 1614 5.42539659412345E-31
ovarian cancer 8492 3.20642893656785E-10
Duchenne muscular dystrophy 602 2.81207196418059E-7
glioblastoma multiforme 347 7.36422343340646E-7
Breast cancer 3099 9.07391109580185E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 8.80955537350212E-5
invasive ductal carcinoma 2950 1.01165387620502E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.86247394538093E-4
ductal carcinoma in situ 1745 0.001393589346947
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00188596457487454
adult high grade glioma 2148 0.00682075129846753
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00715590720912293
colon cancer 1475 0.0125854026717308
non primary Sjogren syndrome sicca 840 0.0181869749197958
facioscapulohumeral dystrophy 286 0.0286837414868368
Disease Target Count Z-score Confidence
Angelman syndrome 38 4.057 2.0
Disease Target Count
Prader-Willi syndrome 45

Expression

Synonym

Accession Q99608 B2R6Z5
Symbols PWCR
HsT16328

Gene

NDN

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

 GO Function (2)

 GO Component (5)

 GO Process (14)

See all...

 Compartment GO Term (17)

See all...

 OMIM Term (1)

 MGI Term (9)

 HCA RNA Cell Line (44)

See all...

Pathway (7)

 UniProt Keyword (8)

Gene RIF (24)

PMID Text
26518708 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas
26384308 Germline single nucleotide polymorphism in necdin gene is associated with breast cancer.
23549060 Hypermethylation and mutation of necdin is associated with neoplasms.
22905258 necdin exerts its pro-survival activity by counteracting the action of the pro-apoptotic protein Cell Cycle Apoptosis Regulatory Protein (CCAR1/CARP1)
22691188 Necdin expression declined during replicative aging of IMR90 primary human fibroblasts or after induction of premature senescence.Showed that in normal human cells, Necdin expression mimicked the effect of p53 inactivation by increasing radioresistance.
22442722 necdin has multiple roles within protein complexes in different subcellular compartments, and indicate that it can utilize multiple karyopherin-dependent pathways to modulate its localization.
22305984 In pre-adipocytes, necdin over-expression inhibits adipogenesis, while reducing necdin levels enhances adipogenic differentiation in tissue culture cell
22046235 Necdin, a negative growth regulator,identified as a novel STAT3 target gene, whose expression is down-regulated at the mRNA and protein levels when STAT3 is constitutively active.
21912643 Necdin is implicated through the TNF-receptor 1 pathway in the developmental death of motoneuron
21543378 rare variant of necdin (p.V318A) was described in a family with Kallmann syndrome Familial segregation and in vitro analysis suggested that this non-synonymous variant did not have a direct causative role in hypogonadism phenotype.
More...

AA Sequence 

MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL      1 - 70
QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL     71 - 140
RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV    141 - 210
WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA    211 - 280
RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED                                 281 - 321
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26518708 2015 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas.
26384308 2015 Necdin is a breast cancer metastasis suppressor that regulates the transcription of c-Myc.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23549060 2013 Putative tumour suppressor gene necdin is hypermethylated and mutated in human cancer.
22905258 2012 Necdin enhances myoblasts survival by facilitating the degradation of the mediator of apoptosis CCAR1/CARP1.
22691188 2012 Necdin modulates proliferative cell survival of human cells in response to radiation-induced genotoxic stress.
22442722 2012 Functional consequences of necdin nucleocytoplasmic localization.
22305984 2012 Loss of the Prader-Willi obesity syndrome protein necdin promotes adipogenesis.
22046235 2011 Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.
More...