| Tbio | Necdin |
Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences (By similarity).
This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| breast carcinoma | 1638 | 5.4e-31 |
| ovarian cancer | 8520 | 3.2e-10 |
| Breast cancer | 3578 | 3.0e-09 |
| Duchenne muscular dystrophy | 601 | 2.8e-07 |
| glioblastoma multiforme | 142 | 7.4e-07 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 8.8e-05 |
| invasive ductal carcinoma | 2951 | 1.0e-04 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 5.9e-04 |
| ductal carcinoma in situ | 1745 | 1.4e-03 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.9e-03 |
| adult high grade glioma | 3801 | 6.8e-03 |
| autosomal dominant Emery-Dreifuss muscular dystrophy | 510 | 7.2e-03 |
| colon cancer | 1478 | 1.3e-02 |
| non primary Sjogren syndrome sicca | 891 | 1.8e-02 |
| facioscapulohumeral dystrophy | 288 | 2.9e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Angelman syndrome | 34 | 4.047 | 2.0 |
| Disease | log2 FC | p |
|---|---|---|
| adult high grade glioma | -1.800 | 6.8e-03 |
| autosomal dominant Emery-Dreifuss muscul... | 1.116 | 7.2e-03 |
| Breast cancer | -1.800 | 3.0e-09 |
| breast carcinoma | -1.400 | 5.4e-31 |
| colon cancer | -2.100 | 1.3e-02 |
| Duchenne muscular dystrophy | 1.310 | 2.8e-07 |
| ductal carcinoma in situ | -1.600 | 1.4e-03 |
| facioscapulohumeral dystrophy | 1.300 | 2.9e-02 |
| glioblastoma multiforme | -1.200 | 7.4e-07 |
| intraductal papillary-mucinous adenoma (... | -2.800 | 8.8e-05 |
| intraductal papillary-mucinous carcinoma... | -2.700 | 5.9e-04 |
| intraductal papillary-mucinous neoplasm ... | -3.000 | 1.9e-03 |
| invasive ductal carcinoma | -2.500 | 1.0e-04 |
| non primary Sjogren syndrome sicca | 1.200 | 1.8e-02 |
| ovarian cancer | -3.900 | 3.2e-10 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG |
MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL 1 - 70 QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL 71 - 140 RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV 141 - 210 WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA 211 - 280 RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED 281 - 321 //
