Tbio | Necdin |
Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences (By similarity).
This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Animal Mammary Neoplasms | 136 |
Disease | Target Count | P-value |
---|---|---|
breast carcinoma | 1614 | 5.42539659412345E-31 |
ovarian cancer | 8492 | 3.20642893656785E-10 |
Duchenne muscular dystrophy | 602 | 2.81207196418059E-7 |
glioblastoma multiforme | 347 | 7.36422343340646E-7 |
Breast cancer | 3099 | 9.07391109580185E-6 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 8.80955537350212E-5 |
invasive ductal carcinoma | 2950 | 1.01165387620502E-4 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 5.86247394538093E-4 |
ductal carcinoma in situ | 1745 | 0.001393589346947 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00188596457487454 |
adult high grade glioma | 2148 | 0.00682075129846753 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 499 | 0.00715590720912293 |
colon cancer | 1475 | 0.0125854026717308 |
non primary Sjogren syndrome sicca | 840 | 0.0181869749197958 |
facioscapulohumeral dystrophy | 286 | 0.0286837414868368 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Angelman syndrome | 38 | 4.057 | 2.0 |
Disease | Target Count |
---|---|
Prader-Willi syndrome | 45 |
Disease | log2 FC | p |
---|---|---|
glioblastoma multiforme | -1.200 | 0.000 |
Duchenne muscular dystrophy | 1.310 | 0.000 |
autosomal dominant Emery-Dreifuss muscul... | 1.116 | 0.007 |
intraductal papillary-mucinous adenoma (... | -2.800 | 0.000 |
intraductal papillary-mucinous carcinoma... | -2.700 | 0.001 |
intraductal papillary-mucinous neoplasm ... | -3.000 | 0.002 |
colon cancer | -2.100 | 0.013 |
adult high grade glioma | -1.800 | 0.007 |
non primary Sjogren syndrome sicca | 1.200 | 0.018 |
Breast cancer | -2.400 | 0.000 |
breast carcinoma | -1.400 | 0.000 |
ductal carcinoma in situ | -1.600 | 0.001 |
invasive ductal carcinoma | -2.500 | 0.000 |
ovarian cancer | -3.900 | 0.000 |
facioscapulohumeral dystrophy | 1.300 | 0.029 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26518708 | NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas |
26384308 | Germline single nucleotide polymorphism in necdin gene is associated with breast cancer. |
23549060 | Hypermethylation and mutation of necdin is associated with neoplasms. |
22905258 | necdin exerts its pro-survival activity by counteracting the action of the pro-apoptotic protein Cell Cycle Apoptosis Regulatory Protein (CCAR1/CARP1) |
22691188 | Necdin expression declined during replicative aging of IMR90 primary human fibroblasts or after induction of premature senescence.Showed that in normal human cells, Necdin expression mimicked the effect of p53 inactivation by increasing radioresistance. |
22442722 | necdin has multiple roles within protein complexes in different subcellular compartments, and indicate that it can utilize multiple karyopherin-dependent pathways to modulate its localization. |
22305984 | In pre-adipocytes, necdin over-expression inhibits adipogenesis, while reducing necdin levels enhances adipogenic differentiation in tissue culture cell |
22046235 | Necdin, a negative growth regulator,identified as a novel STAT3 target gene, whose expression is down-regulated at the mRNA and protein levels when STAT3 is constitutively active. |
21912643 | Necdin is implicated through the TNF-receptor 1 pathway in the developmental death of motoneuron |
21543378 | rare variant of necdin (p.V318A) was described in a family with Kallmann syndrome Familial segregation and in vitro analysis suggested that this non-synonymous variant did not have a direct causative role in hypogonadism phenotype. |
More... |
MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL 1 - 70 QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL 71 - 140 RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV 141 - 210 WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA 211 - 280 RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED 281 - 321 //
PMID | Year | Title |
---|---|---|
26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
26518708 | 2015 | NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas. |
26384308 | 2015 | Necdin is a breast cancer metastasis suppressor that regulates the transcription of c-Myc. |
24722188 | 2014 | Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism. |
23549060 | 2013 | Putative tumour suppressor gene necdin is hypermethylated and mutated in human cancer. |
22905258 | 2012 | Necdin enhances myoblasts survival by facilitating the degradation of the mediator of apoptosis CCAR1/CARP1. |
22691188 | 2012 | Necdin modulates proliferative cell survival of human cells in response to radiation-induced genotoxic stress. |
22442722 | 2012 | Functional consequences of necdin nucleocytoplasmic localization. |
22305984 | 2012 | Loss of the Prader-Willi obesity syndrome protein necdin promotes adipogenesis. |
22046235 | 2011 | Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer. |
More... |