Property Summary

NCBI Gene PubMed Count 43
Grant Count 42
R01 Count 31
Funding $2,995,058.43
PubMed Score 160.94
PubTator Score 58.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26518708 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas
26384308 Germline single nucleotide polymorphism in necdin gene is associated with breast cancer.
23549060 Hypermethylation and mutation of necdin is associated with neoplasms.
22905258 necdin exerts its pro-survival activity by counteracting the action of the pro-apoptotic protein Cell Cycle Apoptosis Regulatory Protein (CCAR1/CARP1)
22691188 Necdin expression declined during replicative aging of IMR90 primary human fibroblasts or after induction of premature senescence.Showed that in normal human cells, Necdin expression mimicked the effect of p53 inactivation by increasing radioresistance.
22442722 necdin has multiple roles within protein complexes in different subcellular compartments, and indicate that it can utilize multiple karyopherin-dependent pathways to modulate its localization.
22305984 In pre-adipocytes, necdin over-expression inhibits adipogenesis, while reducing necdin levels enhances adipogenic differentiation in tissue culture cell
22046235 Necdin, a negative growth regulator,identified as a novel STAT3 target gene, whose expression is down-regulated at the mRNA and protein levels when STAT3 is constitutively active.
21912643 Necdin is implicated through the TNF-receptor 1 pathway in the developmental death of motoneuron
21543378 rare variant of necdin (p.V318A) was described in a family with Kallmann syndrome Familial segregation and in vitro analysis suggested that this non-synonymous variant did not have a direct causative role in hypogonadism phenotype.
More...

AA Sequence

MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL      1 - 70
QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL     71 - 140
RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV    141 - 210
WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA    211 - 280
RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED                                 281 - 321
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26518708 2015 NDN and CD1A are novel prognostic methylation markers in patients with head and neck squamous carcinomas.
26384308 2015 Necdin is a breast cancer metastasis suppressor that regulates the transcription of c-Myc.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23549060 2013 Putative tumour suppressor gene necdin is hypermethylated and mutated in human cancer.
22905258 2012 Necdin enhances myoblasts survival by facilitating the degradation of the mediator of apoptosis CCAR1/CARP1.
22691188 2012 Necdin modulates proliferative cell survival of human cells in response to radiation-induced genotoxic stress.
22442722 2012 Functional consequences of necdin nucleocytoplasmic localization.
22305984 2012 Loss of the Prader-Willi obesity syndrome protein necdin promotes adipogenesis.
22046235 2011 Necdin, a negative growth regulator, is a novel STAT3 target gene down-regulated in human cancer.
More...