| Tbio | ETS-related transcription factor Elf-4 |
Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. Acts synergistically with RUNX1 to transactivate the IL3 promoter (By similarity). Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T-cells via the Kruppel-like factors KLF4 and KLF2 (By similarity). Controls cell senescence in a p53-dependent manner. Can also promote cellular transformation through inhibition of the p16 pathway.
The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jan 2010]
The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jan 2010]
Comments
Property Summary
| NCBI Gene PubMed Count | 23 |
| Grant Count | 16 |
| R01 Count | 9 |
| Funding | $1,269,701.4 |
| PubMed Score | 29.83 |
| PubTator Score | 231.36 |
| Disease | log2 FC | p |
|---|---|---|
| osteosarcoma | -1.128 | 0.016 |
| ependymoma | 1.700 | 0.000 |
| glioblastoma | 1.700 | 0.002 |
| primitive neuroectodermal tumor | 1.300 | 0.020 |
| adrenocortical carcinoma | 1.806 | 0.000 |
| pancreatic ductal adenocarcinoma liver m... | 1.101 | 0.014 |
| intraductal papillary-mucinous adenoma (... | 2.300 | 0.000 |
| intraductal papillary-mucinous carcinoma... | 2.100 | 0.002 |
| intraductal papillary-mucinous neoplasm ... | 2.400 | 0.006 |
| lung cancer | -2.200 | 0.001 |
| active Crohn's disease | -1.076 | 0.014 |
| pancreatic cancer | 1.300 | 0.000 |
| pediatric high grade glioma | 1.500 | 0.000 |
| inflammatory breast cancer | 1.300 | 0.005 |
| lung carcinoma | -1.100 | 0.000 |
| acute myeloid leukemia | 1.500 | 0.003 |
| ovarian cancer | 2.000 | 0.000 |
| PMID | Text |
|---|---|
| 25482012 | The genes BCL6, NFE2, POU4F2 and ELF4 are primary 1,25(OH)2D3 targets in THP-1 cells |
| 25081543 | The p53-MDM2-MEF axis is a feedback mechanism that exquisitely controls the balance of these transcriptional regulators. |
| 24162774 | HIV-1 gp120 upregulates the expression of E74-like factor 4 (ELF4) in human B cells |
| 23393136 | enhanced HDM2 expression induced by mutant NPM1 may have a role in MEF/ELF4-dependent leukemogenesis |
| 23217424 | These studies implicate MEF as a previously unrecognized gatekeeper gene in gliomagenesis that promotes stem cell characteristics through Sox2 activation. |
| 21465527 | MEF is involved in PTH suppression of osteoblasts through activating the MKK4/JNK1 pathway and subsequently up-regulating Mab21l1 expression. |
| 21350194 | Loss of ELF4 leads to increased quiescence in bone marrow endothelial cells by the deregulation of cyclin-dependent kinase-4 expression and to enhanced regeneration of sinusoidal blood vessels. |
| 16303180 | RT-PCR analysis of RNA isolated from bone marrow samples from the patient demonstrates that the translocation occurs within intron 1 of ERG isoform 1 and intron 2 of ELF4 resulting in an in-frame fusion joining exon 2 from ELF4 with exon 2 of ERG. |
| 15907486 | regulation in epithelial cells by Sp1 |
| 15013761 | MEF activated HBD2 promoter activity, and increased the endogenous HBD2 transcription level. The activated HBD2 promoter activity was attenuated by the antisense MEF RNA input and the loss of the ETS binding site in the HBD2 promoter |
| More... |
MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNGIITDGTLCMT 1 - 70 QDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASE 71 - 140 PDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIY 141 - 210 LWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAK 211 - 280 VEGQRLVYQFKEMPKDLVVIEDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEK 281 - 350 PKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQ 351 - 420 TIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLL 421 - 490 AGANRPTNPAPPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLL 491 - 560 VPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPVAELELSSGSGSLLMAEPS 561 - 630 VTTSGSLLTRSPTPAPFSPFNPTSLIKMEPHDI 631 - 663 //
| PMID | Year | Title |
|---|---|---|
| 25482012 | 2015 | The transcriptional regulator BCL6 participates in the secondary gene regulatory response to vitamin D. |
| 25081543 | 2014 | The transcription factor MEF/Elf4 is dually modulated by p53-MDM2 axis and MEF-MDM2 autoregulatory mechanism. |
| 23393136 | 2013 | Mutations in the nucleolar phosphoprotein, nucleophosmin, promote the expression of the oncogenic transcription factor MEF/ELF4 in leukemia cells and potentiates transformation. |
| 23217424 | 2012 | MEF promotes stemness in the pathogenesis of gliomas. |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
| 23064961 | 2013 | GWAS of dental caries patterns in the permanent dentition. |
| 21465527 | 2011 | PTH regulates myleoid ELF-1-like factor (MEF)-induced MAB-21-like-1 (MAB21L1) expression through the JNK1 pathway. |
| 21350194 | 2011 | The transcription factor E74-like factor controls quiescence of endothelial cells and their resistance to myeloablative treatments in bone marrow. |
| 20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. |
| 19690332 | 2009 | Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
| More... |
