Property Summary

NCBI Gene PubMed Count 23
Grant Count 16
R01 Count 9
Funding $1,269,701.4
PubMed Score 29.83
PubTator Score 231.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
25482012 The genes BCL6, NFE2, POU4F2 and ELF4 are primary 1,25(OH)2D3 targets in THP-1 cells
25081543 The p53-MDM2-MEF axis is a feedback mechanism that exquisitely controls the balance of these transcriptional regulators.
24162774 HIV-1 gp120 upregulates the expression of E74-like factor 4 (ELF4) in human B cells
23393136 enhanced HDM2 expression induced by mutant NPM1 may have a role in MEF/ELF4-dependent leukemogenesis
23217424 These studies implicate MEF as a previously unrecognized gatekeeper gene in gliomagenesis that promotes stem cell characteristics through Sox2 activation.
21465527 MEF is involved in PTH suppression of osteoblasts through activating the MKK4/JNK1 pathway and subsequently up-regulating Mab21l1 expression.
21350194 Loss of ELF4 leads to increased quiescence in bone marrow endothelial cells by the deregulation of cyclin-dependent kinase-4 expression and to enhanced regeneration of sinusoidal blood vessels.
16303180 RT-PCR analysis of RNA isolated from bone marrow samples from the patient demonstrates that the translocation occurs within intron 1 of ERG isoform 1 and intron 2 of ELF4 resulting in an in-frame fusion joining exon 2 from ELF4 with exon 2 of ERG.
15907486 regulation in epithelial cells by Sp1
15013761 MEF activated HBD2 promoter activity, and increased the endogenous HBD2 transcription level. The activated HBD2 promoter activity was attenuated by the antisense MEF RNA input and the loss of the ETS binding site in the HBD2 promoter
More...

AA Sequence

MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNGIITDGTLCMT      1 - 70
QDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASE     71 - 140
PDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIY    141 - 210
LWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAK    211 - 280
VEGQRLVYQFKEMPKDLVVIEDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEK    281 - 350
PKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQ    351 - 420
TIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLL    421 - 490
AGANRPTNPAPPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLL    491 - 560
VPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPVAELELSSGSGSLLMAEPS    561 - 630
VTTSGSLLTRSPTPAPFSPFNPTSLIKMEPHDI                                         631 - 663
//

Text Mined References (28)

PMID Year Title
25482012 2015 The transcriptional regulator BCL6 participates in the secondary gene regulatory response to vitamin D.
25081543 2014 The transcription factor MEF/Elf4 is dually modulated by p53-MDM2 axis and MEF-MDM2 autoregulatory mechanism.
23393136 2013 Mutations in the nucleolar phosphoprotein, nucleophosmin, promote the expression of the oncogenic transcription factor MEF/ELF4 in leukemia cells and potentiates transformation.
23217424 2012 MEF promotes stemness in the pathogenesis of gliomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
21465527 2011 PTH regulates myleoid ELF-1-like factor (MEF)-induced MAB-21-like-1 (MAB21L1) expression through the JNK1 pathway.
21350194 2011 The transcription factor E74-like factor controls quiescence of endothelial cells and their resistance to myeloablative treatments in bone marrow.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...