Property Summary

NCBI Gene PubMed Count 24
PubMed Score 31.11
PubTator Score 231.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.076 1.4e-02
acute myeloid leukemia 1.100 2.2e-02
adrenocortical carcinoma 1.806 1.1e-06
adult high grade glioma 1.200 3.3e-03
Breast cancer 1.100 3.5e-05
ependymoma 1.700 8.2e-08
glioblastoma 1.400 5.1e-04
intraductal papillary-mucinous adenoma (... 2.300 3.4e-04
intraductal papillary-mucinous carcinoma... 2.100 1.9e-03
intraductal papillary-mucinous neoplasm ... 2.400 6.1e-03
lung cancer -1.100 1.3e-02
lung carcinoma -1.100 3.1e-19
osteosarcoma -1.128 1.6e-02
ovarian cancer 2.000 6.4e-05
pancreatic cancer 1.300 6.0e-05
pancreatic ductal adenocarcinoma liver m... 1.101 1.4e-02
primitive neuroectodermal tumor 1.300 2.0e-02

Gene RIF (14)

AA Sequence

MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNGIITDGTLCMT      1 - 70
QDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASE     71 - 140
PDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIY    141 - 210
LWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAK    211 - 280
VEGQRLVYQFKEMPKDLVVIEDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEK    281 - 350
PKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQ    351 - 420
TIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLL    421 - 490
AGANRPTNPAPPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLL    491 - 560
VPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPVAELELSSGSGSLLMAEPS    561 - 630
VTTSGSLLTRSPTPAPFSPFNPTSLIKMEPHDI                                         631 - 663
//

Text Mined References (29)

PMID Year Title