Property Summary

NCBI Gene PubMed Count 31
Grant Count 37
R01 Count 13
Funding $5,967,128.52
PubMed Score 69.89
PubTator Score 41.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (19)

PMID Text
25239642 High chimeric TSNAX-DISC1 resulting from intergenic splicing is associated with endometrial carcinoma.
25043320 TSNAX protein is known to form a brain enriched complex with translin, that can bind single-stranded DNA and RNA through which it is involved in protein regulation.
24928020 LIS1 and TSNAX genes are not associated with susceptibility to bipolar I disorder in Chinese Han population.
22889834 Data show a novel role of phospholipase Cbeta1 (PLCbeta1) in gene regulation through translin-associated factor X (TRAX) association.
22673686 Our results provide further evidence for sex-dependent effects of the TSNAX/DISC1 locus in the aetiology of schizophrenia and bipolar affective disorder
22427937 TRAX binds to ssDNA and two regions in TRAX, designated TRAXB2 and TRAXB3, mediate nucleic acid binding activity of the trax-translin heteromeric complex.
21552258 C3PO endonuclease is an asymmetric octamer barrel consisting of six translin and two TRAX subunits which activates RISC by degrading the Ago2-nicked passenger strand of siRNA.
20691427 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
19760522 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRT      1 - 70
IFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTR     71 - 140
SLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGD    141 - 210
IDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKT    211 - 280
EMIDQEEGIS                                                                281 - 290
//

Text Mined References (36)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25239642 2014 Identification of chimeric TSNAX-DISC1 resulting from intergenic splicing in endometrial carcinoma through high-throughput RNA sequencing.
25043320 2014 DISC1-TSNAX and DAOA genes in major depression and citalopram efficacy.
24928020 2014 [Association study of LIS1 and TSNAX genes with bipolar disorder in Chinese Han population].
22889834 2012 Phospholipase C?1 is linked to RNA interference of specific genes through translin-associated factor X.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22673686 2012 Gender-specific association of TSNAX/DISC1 locus for schizophrenia and bipolar affective disorder in South Indian population.
22427937 2012 Identification of nucleic acid binding sites on translin-associated factor X (TRAX) protein.
More...