Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
Funding $1,596,832.75
PubMed Score 30.46
PubTator Score 25.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.505 0.007
astrocytic glioma -1.300 0.042
ependymoma -1.200 0.023
psoriasis 1.600 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.001
hereditary spastic paraplegia -1.036 0.014
pancreatic ductal adenocarcinoma liver m... -1.142 0.037
intraductal papillary-mucinous neoplasm ... 1.400 0.007
lung cancer 1.800 0.000
breast carcinoma 1.200 0.000
ductal carcinoma in situ 1.100 0.005
invasive ductal carcinoma 1.300 0.000
ovarian cancer 1.400 0.033
Breast cancer 1.300 0.000

Gene RIF (5)

PMID Text
26977020 TIMM17A has a profound impact on the cellular function of breast cancer cells. A decrease of TIMM17A expression is associated with the reduction of the aggressiveness of breast cancer cells.
20972741 High TIMM17A expression is associated with adverse pathological outcomes in breast cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20198662 mRNA expression analysis and immunohistochemistry analysis in breast cancer tissues indicated that expression level of TIMM17A was directly correlated with tumor progression; survival analysis suggested TIMM17A was a prognosis factor in breast cancer.
18826960 Tim17 is a conserved suppressor of mtDNA instability.

AA Sequence

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWG      1 - 70
GLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQ     71 - 140
FPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ                                           141 - 171
//

Text Mined References (17)

PMID Year Title
26977020 2016 The Impact of TIMM17A on Aggressiveness of Human Breast Cancer Cells.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20972741 2012 High TIMM17A expression is associated with adverse pathological and clinical outcomes in human breast cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20198662 2010 Quantitative proteomics study of breast cancer cell lines isolated from a single patient: discovery of TIMM17A as a marker for breast cancer.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
18826960 2009 The conserved translocase Tim17 prevents mitochondrial DNA loss.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...