Property Summary

NCBI Gene PubMed Count 15
PubMed Score 33.08
PubTator Score 25.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.300 4.2e-02
atypical teratoid / rhabdoid tumor -1.300 1.2e-05
Breast cancer 1.300 1.5e-06
breast carcinoma 1.200 1.0e-21
ductal carcinoma in situ 1.100 5.1e-03
ependymoma -1.200 2.3e-02
hereditary spastic paraplegia -1.036 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 7.3e-03
invasive ductal carcinoma 1.300 1.0e-04
lung cancer 1.600 1.9e-03
medulloblastoma -1.100 1.5e-04
medulloblastoma, large-cell -1.100 1.3e-03
Multiple myeloma 1.105 1.2e-02
ovarian cancer -1.200 9.5e-04
pancreatic ductal adenocarcinoma liver m... -1.142 3.7e-02
psoriasis 1.600 8.7e-05

Gene RIF (5)

AA Sequence

MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWG      1 - 70
GLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQ     71 - 140
FPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ                                           141 - 171
//

Text Mined References (17)

PMID Year Title