Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.82
PubTator Score 8.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Gestational choriocarcinoma 5 3.511 1.8

Expression

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MASNSWNASSSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRN      1 - 70
ELIARYIKLRTGKTRTRKQVSSHIQVLARKKVREYQVGIKAMNLDQVSKDKALQSMASMSSAQIVSASVL     71 - 140
QNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAA    141 - 210
SVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKG    211 - 280
GLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEY    281 - 350
ARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVST    351 - 420
SEHGAQHHVYKLVKD                                                           421 - 435
//

Text Mined References (21)

PMID Year Title