Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 4
Funding $160,195.95
PubMed Score 11.81
PubTator Score 8.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Gestational choriocarcinoma 3 3.45 1.7

Expression

Synonym

Accession Q99594 O95910 Q5BJG7 Q8N6Y4
Symbols TEF5
TEAD5
TEF-5
DTEF-1
ETFR-1
TEAD-3

Gene

PANTHER Protein Class (1)

PDB

5EMW  

Gene RIF (6)

PMID Text
26487755 Sequences at the 9p21.3 risk locus disrupt TEAD factor binding and TEAD3-dependent TGF-beta induction of p16 in HAoSMCs. TEAD3 overexpression induced p16 in HAoSMCs homozygous for the nonrisk coronary disease allele, but not for the risk allele.
25995450 TAZ negatively regulate transcription of DeltaNp63 through TEAD1,2,3 and 4 transcription factors.
23576552 Data indicate that knockdown of TEAD1/3/4 induces an almost identical cellular senescent phenotype as YAP silencing.
15131259 Transcription enhancer factor-5 and the GATA-like protein act in a coordinate manner to determine the placental-specific expression of the human 3beta-hydroxysteroid dehydrogenase/isomerase I enzyme
10379887 The paper described that the translation initiation codon for the TEF-5 protein was a non-AUG (AUA) codon.
9148898 The paper described that the translation initiation codon for the TEF-5 protein was a non-AUG (ATA) codon.

AA Sequence

MASNSWNASSSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRN      1 - 70
ELIARYIKLRTGKTRTRKQVSSHIQVLARKKVREYQVGIKAMNLDQVSKDKALQSMASMSSAQIVSASVL     71 - 140
QNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAA    141 - 210
SVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKG    211 - 280
GLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEY    281 - 350
ARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVST    351 - 420
SEHGAQHHVYKLVKD                                                           421 - 435
//

Text Mined References (21)

PMID Year Title
26487755 2015 9p21.3 Coronary Artery Disease Risk Variants Disrupt TEAD Transcription Factor-Dependent Transforming Growth Factor ? Regulation of p16 Expression in Human Aortic Smooth Muscle Cells.
25995450 2015 Hippo Component TAZ Functions as a Co-repressor and Negatively Regulates ?Np63 Transcription through TEA Domain (TEAD) Transcription Factor.
25416956 2014 A proteome-scale map of the human interactome network.
23946438 2013 Developmental stage-dependent transcriptional regulatory pathways control neuroblast lineage progression.
23576552 2013 YAP/TEAD-mediated transcription controls cellular senescence.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19324877 2009 TEAD transcription factors mediate the function of TAZ in cell growth and epithelial-mesenchymal transition.
18579750 2008 TEAD mediates YAP-dependent gene induction and growth control.
More...