Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.06
PubTator Score 17.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, AUTOSOMAL DOMINANT 22 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Retinal disease 25 0.0 2.7
Disease Target Count Z-score Confidence
Microcephaly 166 4.497 2.2
Retinitis Pigmentosa 226 3.656 1.8
Disease Target Count
Distal monosomy 1q 1

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 4.4e-02
atypical teratoid / rhabdoid tumor -2.100 2.4e-05
Common variable immunodeficiency -1.152 4.9e-03
dermatomyositis -1.200 5.1e-03
ductal carcinoma in situ 1.200 2.0e-02
gastric cancer -1.300 4.9e-02
glioblastoma -2.000 1.5e-03
group 4 medulloblastoma 4.600 1.3e-04
lung cancer 1.500 4.3e-02
medulloblastoma, large-cell 2.500 3.2e-06
osteosarcoma -2.058 1.4e-03
ovarian cancer -1.600 8.6e-04
Pick disease -1.500 1.6e-03
pituitary cancer 1.500 1.2e-03
psoriasis -1.200 1.2e-03
subependymal giant cell astrocytoma -4.113 4.6e-03
Waldenstrons macroglobulinemia 1.249 4.7e-02

Gene RIF (6)

AA Sequence

MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIV      1 - 70
TAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDK     71 - 140
VESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGK    141 - 210
TVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASC    211 - 280
DESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGG    281 - 350
MESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFS    351 - 420
CMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHC    421 - 490
ELVNSLSVKSEALSLPTVRDWTLEDSSQELWK                                          491 - 522
//

Text Mined References (26)

PMID Year Title