Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 6
Funding $680,750.25
PubMed Score 15.86
PubTator Score 17.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer -1.300 0.049
Waldenstrons macroglobulinemia 1.249 0.047
psoriasis -1.200 0.001
glioblastoma -2.000 0.001
osteosarcoma -2.058 0.001
group 4 medulloblastoma 4.600 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell 2.500 0.000
Common variable immunodeficiency -1.152 0.005
lung cancer 1.500 0.043
adult high grade glioma -1.300 0.044
subependymal giant cell astrocytoma -4.113 0.005
Pick disease -1.500 0.002
ductal carcinoma in situ 1.200 0.020
ovarian cancer -1.600 0.001
pituitary cancer 1.500 0.001
dermatomyositis -1.200 0.005

Synonym

Accession Q99592 A8K5U3 Q13397 Q5VU40 Q8N463 Q9UD99
Symbols RP58
MRD22
TAZ-1
ZNF238
C2H2-171

Gene

Gene RIF (3)

PMID Text
25817480 repression of the CR2/CD21 promoter can occur through one of the E-box motifs via recruitment of RP58.
22095278 RP58 may act to favor neuronal differentiation and brain growth by coherently repressing multiple proneurogenic genes in a timely manner.
20103640 Findings indicate that ZNF238 is a novel brain tumor suppressor and its reactivation in tumors could open a novel anticancer strategy.

AA Sequence

MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIV      1 - 70
TAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDK     71 - 140
VESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGK    141 - 210
TVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASC    211 - 280
DESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGG    281 - 350
MESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFS    351 - 420
CMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHC    421 - 490
ELVNSLSVKSEALSLPTVRDWTLEDSSQELWK                                          491 - 522
//

Text Mined References (20)

PMID Year Title
25817480 2015 Analysis of tandem E-box motifs within human Complement receptor 2 (CR2/CD21) promoter reveals cell specific roles for RP58, E2A, USF and localized chromatin accessibility.
25416956 2014 A proteome-scale map of the human interactome network.
24193349 2014 A de novo non-sense mutation in ZBTB18 in a patient with features of the 1q43q44 microdeletion syndrome.
22095278 2012 RP58/ZNF238 directly modulates proneurogenic gene levels and is required for neuronal differentiation and brain expansion.
20103640 2010 ZNF238 is expressed in postmitotic brain cells and inhibits brain tumor growth.
20059953 2009 A systems approach reveals that the myogenesis genome network is regulated by the transcriptional repressor RP58.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...