Property Summary

NCBI Gene PubMed Count 16
PubMed Score 65.19
PubTator Score 22.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 1.700 4.4e-02
acute quadriplegic myopathy 1.229 5.0e-07
astrocytic glioma 1.300 1.7e-02
Astrocytoma, Pilocytic 1.200 1.1e-04
atypical teratoid / rhabdoid tumor 1.200 1.2e-05
ependymoma 2.000 2.6e-02
glioblastoma 1.100 2.2e-05
group 3 medulloblastoma 1.200 9.7e-03
intraductal papillary-mucinous adenoma (... 1.700 1.1e-03
intraductal papillary-mucinous carcinoma... 1.100 5.3e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.0e-02
juvenile dermatomyositis 1.062 8.1e-11
medulloblastoma, large-cell -1.500 1.2e-04
oligodendroglioma 1.500 1.2e-02
osteosarcoma 1.284 2.6e-04
ovarian cancer -1.300 1.5e-04
pancreatic cancer 1.300 1.1e-03
pancreatic ductal adenocarcinoma liver m... 1.413 1.0e-03
pediatric high grade glioma 1.500 5.8e-05
Pick disease 1.300 1.7e-04
psoriasis -1.700 6.2e-05
Rheumatoid arthritis 1.200 2.6e-03
tuberculosis -1.400 3.2e-07

Gene RIF (2)

AA Sequence

MKKKTVCTLNMGDKKYEDMEGEENGDNTISTGLLYSEADRCPICLNCLLEKEVGFPESCNHVFCMTCILK      1 - 70
WAETLASCPIDRKPFQAVFKFSALEGYVKVQVKKQLRETKDKKNENSFEKQVSCHENSKSCIRRKAIVRE     71 - 140
DLLSAKVCDLKWIHRNSLYSETGGKKNAAIKINKPQRSNWSTNQCFRNFFSNMFSSVSHSGESSFTYRAY    141 - 210
CTEFIEASEISALIRQKRHELELSWFPDTLPGIGRIGFIPWNVETEVLPLISSVLPRTIFPTSTISFEHF    211 - 280
GTSCKGYALAHTQEGEEKKQTSGTSNTRGSRRKPAMTTPTRRSTRNTRAETASQSQRSPISDNSGCDAPG    281 - 350
NSNPSLSVPSSAESEKQTRQAPKRKSVRRGRKPPLLKKKLRSSVAAPEKSSSNDSVDEETAESDTSPVLE    351 - 420
KEHQPDVDSSNICTVQTHVENQSANCLKSCNEQIEESEKHTANYDTEERVGSSSSESCAQDLPVLVGEEG    421 - 490
EVKKLENTGIEANVLCLESEISENILEKGGDPLEKQDQISGLSQSEVKTDVCTVHLPNDFPTCLTSESKV    491 - 560
YQPVSCPLSDLSENVESVVNEEKITESSLVEITEHKDFTLKTEELIESPKLESSEGEIIQTVDRQSVKSP    561 - 630
EVQLLGHVETEDVEIIATCDTFGNEDFNNIQDSENNLLKNNLLNTKLEKSLEEKNESLTEHPRSTELPKT    631 - 700
HIEQIQKHFSEDNNEMIPMECDSFCSDQNESEVEPSVNADLKQMNENSVTHCSENNMPSSDLADEKVETV    701 - 770
SQPSESPKDTIDKTKKPRTRRSRFHSPSTTWSPNKDTPQEKKRPQSPSPRRETGKESRKSQSPSPKNESA    771 - 840
RGRKKSRSQSPKKDIARERRQSQSRSPKRDTTRESRRSESLSPRRETSRENKRSQPRVKDSSPGEKSRSQ    841 - 910
SRERESDRDGQRRERERRTRKWSRSRSHSRSPSRCRTKSKSSSFGRIDRDSYSPRWKGRWANDGWRCPRG    911 - 980
NDRYRKNDPEKQNENTRKEKNDIHLDADDPNSADKHRNDCPNWITEKINSGPDPRTRNPEKLKESHWEEN    981 - 1050
RNENSGNSWNKNFGSGWVSNRGRGRGNRGRGTYRSSFAYKDQNENRWQNRKPLSGNSNSSGSESFKFVEQ   1051 - 1120
QSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSL   1121 - 1190
KDQTNQQVDGSQLPINMMQPQMNVMQQQMNAQHQPMNIFPYPVGVHAPLMNIQRNPFNIHPQLPLHLHTG   1191 - 1260
VPLMQVATPTSVSQGLPPPPPPPPPSQQVNYIASQPDGKQLQGIPSSSHVSNNMSTPVLPAPTAAPGNTG   1261 - 1330
MVQGPSSGNTSSSSHSKASNAAVKLAESKVSVAVEASADSSKTDKKLQIQEKAAQEVKLAIKPFYQNKDI   1331 - 1400
TKEEYKEIVRKAVDKVCHSKSGEVNSTKVANLVKAYVDKYKYSRKGSQKKTLEEPVSTEKNIG          1401 - 1463
//

Text Mined References (32)

PMID Year Title