Property Summary

NCBI Gene PubMed Count 34
Grant Count 6
R01 Count 4
Funding $257,895.5
PubMed Score 28.84
PubTator Score 30.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
27008379 This is the first report for the association between HMGA1 and S100A13 expression in the modulation of thyroid cancer growth and invasion.
24982031 S100A13 interacts with the C2 domain of RAGE.
24722184 S100A13 is involved in cutaneous malignant melanoma resistance to DTIC/TMZ.
21270123 the IL1alpha-S100A13 tetrameric complex is the key complex formed during the non-classical pathway of IL1alpha release
20863990 S100A13 promotes the release of FGF-1 protein, but does not affect the transportation of FGF-1 protein in human umbilical vein endothelial cells.
20208480 S100A13 is expressed in melanocytic lesions when the angiogenic switch occurs and it may cooperate with VEGF-A in supporting the formation of new blood vessels, favoring the shift from radial to vertical tumor growth.
18259052 Despite the high similarity of the backbone conformation in each protomer, the crystal structures of human S100A13 at pH 7.5 and at pH 6.0 exhibit recognizable differences in the relative orientation of the protomers within the dimer
17374362 S100A13 is a homodimer with four EF-hand motifs in an asymmetric unit, displaying a folding pattern similar to other S100 members. S100A13 has the unique structural feature with all alpha-helices being amphiphilic.
17077500 Human S100A13 was heterologously expressed in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method.
16773219 In human astrocytic gliomas, S100A13 was significantly up-regulated in high-grade vascularized gliomas. Moreover, S100A13 expression significantly correlated with microvessel density and tumour grading.
More...

AA Sequence

MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE      1 - 70
LKFNEYWRLIGELAKEIRKKKDLKIRKK                                               71 - 98
//

Text Mined References (35)

PMID Year Title
27008379 2016 The association between S100A13 and HMGA1 in the modulation of thyroid cancer proliferation and invasion.
25416956 2014 A proteome-scale map of the human interactome network.
24982031 2014 Interaction of S100A13 with C2 domain of receptor for advanced glycation end products (RAGE).
24722184 2014 Proteomics analysis of melanoma metastases: association between S100A13 expression and chemotherapy resistance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21270123 2011 The IL1alpha-S100A13 heterotetrameric complex structure: a component in the non-classical pathway for interleukin 1alpha secretion.
21269460 2011 Initial characterization of the human central proteome.
20863990 2010 Effect of human S100A13 gene silencing on FGF-1 transportation in human endothelial cells.
20208480 2010 S100A13 is a new angiogenic marker in human melanoma.
19284995 2009 S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway.
More...