Property Summary

NCBI Gene PubMed Count 21
Grant Count 63
R01 Count 44
Funding $9,299,163.63
PubMed Score 504.08
PubTator Score 69.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.000 0.000

Gene RIF (9)

PMID Text
24731854 Here we review the activities of MYC, MNT and other MAX interacting proteins in the setting of T and B cell activation and oncogenesis
23860446 The data demonstrate that the balance between c-Myc and Mnt activity determines the transcriptional outcome of the hTERT promoter by modulation of the chromatin architecture.
22964333 The results suggest that MNT, via interaction with Nck1, inhibits hepatoma cell migration.
19086036 The switch from Mnt-Max to Myc-Max during bile duct ligation (cholestasis) and in hepatocytes treated with lithocholic acid is responsible for the induction in p53 and cyclin D1 expression and contributes to apoptosis.
18457265 Missense mutations in Mad1, Mxi1 and Rox were found in acute leukemia patients.
18155722 Mxd1 D112a and Max N78a and H81d, which are located in the leucine zippers of the proteins, can dictate the specificity of heterodimerization and whether or not the Mxd1/Max/DNA complex forms.
17577784 Mad1, Mxi1 and Rox genes were expressed and displayed mutations in haematological malignancies.
17419941 Serum stimulation of quiescent cells results in phosphorylation of Mnt and disruption of the critical Mnt-mSin3-HDAC1 interaction. This in turn leads to increased expression of the Myc/Mnt target gene cyclin D2. Review.
15258910 downregulation MYCN was reflected in a decreased MYCN/Max DNA-binding activity while the Mnt/Max binding did not change during differentiation

AA Sequence

MSIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPP      1 - 70
APPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQPALVGAPGLSIKEPAPLPSR     71 - 140
PQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHPGVQPQLAPQQPPPPTLGTLKLAPAEEVKSS    141 - 210
EQKKRPGGIGTREVHNKLEKNRRAHLKECFETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEH    211 - 280
EMERLAREKIATQQRLAELKHELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGL    281 - 350
GPPKLSHRPQPELLKSTLPPPSTTPAPLPPHPHPHPHSVALPPAHLPVQQQQPQQKTPLPAPPPPPAAPA    351 - 420
QTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQLAPATPPIGH    421 - 490
ITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPATVMAKPAVGAQVVHHPQLVGQ    491 - 560
TVLNPVTMVTMPSFPVSTLKLA                                                    561 - 582
//

Text Mined References (22)

PMID Year Title
24731854 2015 The activities of MYC, MNT and the MAX-interactome in lymphocyte proliferation and oncogenesis.
23860446 2013 Chromatin dynamics at the hTERT promoter during transcriptional activation and repression by c-Myc and Mnt in Xenopus leavis oocytes.
22964333 2012 Identification of Max binding protein as a novel binding protein of Nck1 and characterization of its role in inhibiting human liver cancer SK-HEP-1 cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19086036 2009 Switch from Mnt-Max to Myc-Max induces p53 and cyclin D1 expression and apoptosis during cholestasis in mouse and human hepatocytes.
18457265 2007 [Expression and mutation of myc antagonist genes Mad1, Mxi1 and Rox in leukemia cells].
18155722 2008 Elucidation of the structural determinants responsible for the specific formation of heterodimeric Mxd1/Max b-HLH-LZ and its binding to E-box sequences.
17577784 2007 Expression and mutation analysis of genes that encode the Myc antagonists Mad1, Mxi1 and Rox in acute leukaemia.
17419941 2007 Mnt takes control as key regulator of the myc/max/mxd network.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...