Property Summary

NCBI Gene PubMed Count 18
Grant Count 70
R01 Count 42
Funding $8,720,813.86
PubMed Score 68.50
PubTator Score 169.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.081 0.000
medulloblastoma 1.500 0.022
medulloblastoma, large-cell 2.300 0.000
adult high grade glioma 1.200 0.026
ovarian cancer 1.100 0.000
pituitary cancer 1.500 0.012

Synonym

Accession Q99581
Symbols PET-1
HSRNAFEV

Gene

FEV

PANTHER Protein Class (1)

PDB

2YPR   3ZP5  

Gene RIF (14)

PMID Text
26122139 Genetic variation in FEV1 was associated with serum 25-Hydroxyvitamin D status.
24100022 novel evidence for the role of Pet-1 in human amygdala threat processing extends literature demonstrating the influence of genetic variation in the serotonin system on emotional regulation
23591790 Fev-ERK signaling is essential for hemogenic endothelium-based hematopoietic stem cell development.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20480378 our data argue against an exclusive role of FEV in the adult human brain serotonergic system and genetic analyses did not suggest that FEV variation adds to the genetic liability towards affective disorders
20468064 Observational study of gene-disease association. (HuGE Navigator)
20048018 FEV identifies serotonin-producing cells in normal and neoplastic small intestine.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19707175 Serotonin-related FEV gene variant in the sudden infant death syndrome is a common polymorphism in the African-American population.
19707175 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEG      1 - 70
GHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPA     71 - 140
HAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGPAATAAAATAA    141 - 210
LYPSPSLQPPPGPFGAVAAASHLGGHYH                                              211 - 238
//

Text Mined References (22)

PMID Year Title
26122139 2015 Association of 25-Hydroxyvitamin D status and genetic variation in the vitamin D metabolic pathway with FEV1 in the Framingham Heart Study.
24100022 2013 Convergent effects of mouse Pet-1 deletion and human PET-1 variation on amygdala fear and threat processing.
23591790 2013 Fev regulates hematopoietic stem cell development via ERK signaling.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20480378 2010 The expression of the transcription factor FEV in adult human brain and its association with affective disorders.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20048018 2010 The ETS oncogene family transcription factor FEV identifies serotonin-producing cells in normal and neoplastic small intestine.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19707175 2009 Serotonin-related FEV gene variant in the sudden infant death syndrome is a common polymorphism in the African-American population.
More...