Property Summary

NCBI Gene PubMed Count 19
PubMed Score 71.68
PubTator Score 169.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count Z-score Confidence
Ewing sarcoma 25 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 2.6e-02
group 4 medulloblastoma 1.300 2.3e-02
medulloblastoma, large-cell 2.300 6.1e-05
osteosarcoma 1.081 3.0e-04
ovarian cancer 1.100 7.8e-08
pituitary cancer 1.500 1.2e-02

Gene RIF (15)

AA Sequence

MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEG      1 - 70
GHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPA     71 - 140
HAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGPAATAAAATAA    141 - 210
LYPSPSLQPPPGPFGAVAAASHLGGHYH                                              211 - 238
//

Text Mined References (23)

PMID Year Title