Property Summary

NCBI Gene PubMed Count 31
Grant Count 18
R01 Count 5
Funding $1,976,266.65
PubMed Score 783.81
PubTator Score 399.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (15)

PMID Text
26334395 The current meta-analysis suggested that rs12456492 might be associated with increased PD risk in Asian populations, but studies using larger sample sizes and different ethnic populations will be needed to further confirm this association.
26188085 the G allele, GG and GA genotype of rs12456492(A/G) polymorphism may increase the risk of Parkinson disease. [meta-analysis]
25559334 performed a case-control replication study in this population and investigated RIT2 rs12456492 variant in a large cohort of Chinese Han individuals
25534083 The data of this study suggested that the RIT2 polymorphisms are associated with Parkinson disease etiology.
25457028 Its polymorphism is associated with Parkinson's disease in a Han Chinese population.
25146456 findings increase the likelihood of association between Parkinson's disease and RIT2 variant in Asian populations
23805044 These studies confirm the expression of RIT2 in retinal neuronal cells.
23635658 failed to replicate the RIT2 rs12456492 variant as a genetic risk factor for Parkinson's disease in our population.
22451204 This meta-analysis identifies a novel Parkinson's disease locus, RIT2, that replicates several previously identified loci on chromosome 18.
21957239 Rin interacts directly with dopamine transporter DAT in a protein kinase (PK)C-regulated manner and is required for PKC-mediated DAT internalization.
More...

AA Sequence

MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYL      1 - 70
DILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQF     71 - 140
RQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLK    141 - 210
KKRENMT                                                                   211 - 217
//

Text Mined References (32)

PMID Year Title
26334395 2015 Genetic association of RIT2 rs12456492 polymorphism and Parkinson's disease susceptibility in Asian populations: a meta-analysis.
26188085 2015 RIT2 rs12456492 polymorphism and the risk of Parkinson's disease: A meta-analysis.
25559334 2015 Assessment of RIT2 rs12456492 association with Parkinson's disease in Mainland China.
25534083 2015 The RIT2 and STX1B polymorphisms are associated with Parkinson's disease.
25457028 2015 RIT2 polymorphism is associated with Parkinson's disease in a Han Chinese population.
25146456 2014 RIT2, a susceptibility gene for Parkinson's disease in Iranian population.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23805044 2013 RIT2, a neuron-specific small guanosine triphosphatase, is expressed in retinal neuronal cells and its promoter is modulated by the POU4 transcription factors.
More...