Property Summary

NCBI Gene PubMed Count 33
PubMed Score 791.74
PubTator Score 399.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -3.300 4.1e-04
astrocytic glioma -3.900 1.1e-03
atypical teratoid / rhabdoid tumor -4.800 2.7e-08
ependymoma -3.600 8.8e-03
glioblastoma -2.100 2.1e-03
group 3 medulloblastoma -4.700 1.7e-05
medulloblastoma, large-cell -5.600 4.6e-08
oligodendroglioma -1.200 1.0e-04
Pick disease -1.400 4.4e-03
primitive neuroectodermal tumor -2.400 3.7e-02
subependymal giant cell astrocytoma -4.249 8.6e-04

Gene RIF (17)

AA Sequence

MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYL      1 - 70
DILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQF     71 - 140
RQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLK    141 - 210
KKRENMT                                                                   211 - 217
//

Text Mined References (34)

PMID Year Title