Property Summary

NCBI Gene PubMed Count 50
Grant Count 37
R01 Count 14
Funding $6,682,780
PubMed Score 140.38
PubTator Score 71.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
26612340 GILZ is a non-redundant regulator of B cell activity, with important potential clinical implications in systemic lupus erythematosus.
26384220 results reveal GILZ to be a new actor in apoptosis regulation in neutrophil-like cells involving JNK and Mcl-1.
25964494 our data suggest that GILZ is a key regulator of macrophage functions.
25168242 L-GILZ stabilizes p53 proteins by decreasing p53 ubiquitination and increasing MDM2 ubiquitination.
24993177 The N-terminal part of L-GILZ protein is responsible for Ras/L-GILZ protein-to-protein interaction, important for the control of proliferation rate of spermatogonia.
24747114 Data show a diminished expression of the anti-inflammatory mediator GILZ in the inflamed vasculature and indicate that GILZ downregulation requires the mRNA binding protein ZFP36.
24215840 PUVA directly stimulates GILZ expression.
23729444 Exogenous GILZ exerts inhibitory effects on endothelial cell adhesive function via a novel pathway involving modulation of NF-kappaB p65 DNA binding and MAPK activity.
23650723 Delta-sleep inducing peptide entrapment and release from polymer hydrogels based on modified polyvinyl alcohol in vitro
23573276 Inhibition of epithelial injury repair by dexamethasone is mediated in part by activation of GILZ.
More...

AA Sequence

MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR      1 - 70
EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV           71 - 134
//

Text Mined References (56)

PMID Year Title
26612340 2016 Glucocorticoid-induced leucine zipper (GILZ) inhibits B cell activation in systemic lupus erythematosus.
26384220 2016 Glucocorticoid-Induced Leucine Zipper Is Expressed in Human Neutrophils and Promotes Apoptosis through Mcl-1 Down-Regulation.
25964494 2015 Glucocorticoid-induced leucine zipper: a critical factor in macrophage endotoxin tolerance.
25416956 2014 A proteome-scale map of the human interactome network.
25168242 2015 L-GILZ binds p53 and MDM2 and suppresses tumor growth through p53 activation in human cancer cells.
24993177 2014 Recombinant long-glucocorticoid-induced leucine zipper (L-GILZ) protein restores the control of proliferation in gilz KO spermatogonia.
24747114 2014 Downregulation of the glucocorticoid-induced leucine zipper (GILZ) promotes vascular inflammation.
24215840 2014 Activation of GILZ gene by photoactivated 8-methoxypsoralen: potential role of immunoregulatory dendritic cells in extracorporeal photochemotherapy.
23729444 2013 GILZ overexpression inhibits endothelial cell adhesive function through regulation of NF-?B and MAPK activity.
23650723 [Delta-sleep inducing peptide entrapment and release from polymer hydrogels based on modified polyvinyl alcohol in vitro].
More...