Property Summary

NCBI Gene PubMed Count 54
PubMed Score 159.77
PubTator Score 71.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q99576 Q5H9S3 Q5JRI9 Q6FIH6 Q8NAI1 Q8WVB9 Q9UBN5 Q9UG13
Symbols DIP
GILZ
DSIPI
TSC-22R

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (39)

AA Sequence

MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR      1 - 70
EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV           71 - 134
//

Text Mined References (60)

PMID Year Title