Property Summary

NCBI Gene PubMed Count 24
Grant Count 61
R01 Count 39
Funding $6,499,974.59
PubMed Score 0.00
PubTator Score 29.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.303 0.002
group 3 medulloblastoma 1.700 0.000
medulloblastoma, large-cell 1.100 0.000
colon cancer 1.500 0.007
lung cancer 1.600 0.001
Breast cancer 1.300 0.001

Synonym

Accession Q99575 A8K5W9 Q15037 hPOP1
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
26275995 by inhibiting inflammasome assembly, provides a regulatory feedback loop that shuts down excessive inflammatory responses; Cryopyrin-Associated Periodic Syndrome patients exhibit reduced expression
25839653 S-palmitoylation alters conformation or secondary structure of Trx1, as well as decreases the ability of Trx1 to transfer electrons from thioredoxin reductase to S-nitrosylated protein-tyrosine phosphatase 1B and S-nitroso-glutathione
22991464 Mitochondrial ribonuclease P structure provides insight into the evolution of catalytic strategies for precursor-trna 5' processing.
21509594 POP1 gene expression is increased in classic variant of papillary thyroid carcinoma.
21053045 Data idenified two cleavage sites for RNase MRP/RNase P in the coding sequence of viperin mRNA.
20453000 Observational study of gene-disease association. (HuGE Navigator)
16723659 A transient association of protein subunits may be inversely correlated to its involvement in pre-rRNA processing.

AA Sequence

MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPE      1 - 70
VNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMR     71 - 140
RRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAK    141 - 210
RFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAA    211 - 280
VHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCV    281 - 350
EPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGI    351 - 420
IISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELL    421 - 490
GGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK    491 - 560
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAF    561 - 630
WIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGT    631 - 700
LAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAE    701 - 770
EVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGL    771 - 840
TREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILK    841 - 910
QKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGE    911 - 980
ALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV                              981 - 1024
//

Text Mined References (36)

PMID Year Title
26275995 2015 The PYRIN Domain-only Protein POP1 Inhibits Inflammasome Assembly and Ameliorates Inflammatory Disease.
25839653 2015 Crystal structure of human POP1 and its distinct structural feature for PYD domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22991464 2012 Mitochondrial ribonuclease P structure provides insight into the evolution of catalytic strategies for precursor-tRNA 5' processing.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21455487 2011 Whole-exome re-sequencing in a family quartet identifies POP1 mutations as the cause of a novel skeletal dysplasia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...