Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 29.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Anauxetic dysplasia 2 0.0 5.0
Disease Target Count P-value
group 3 medulloblastoma 4104 3.2e-05
medulloblastoma, large-cell 6241 9.2e-05
lung cancer 4740 1.0e-03
Breast cancer 3577 1.2e-03
osteosarcoma 7950 2.4e-03
colon cancer 1478 7.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Prion disease 16 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.300 1.2e-03
colon cancer 1.500 7.1e-03
group 3 medulloblastoma 1.700 3.2e-05
lung cancer 1.600 1.0e-03
medulloblastoma, large-cell 1.100 9.2e-05
osteosarcoma -1.303 2.4e-03

Gene RIF (8)

AA Sequence

MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPE      1 - 70
VNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMR     71 - 140
RRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAK    141 - 210
RFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAA    211 - 280
VHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCV    281 - 350
EPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGI    351 - 420
IISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELL    421 - 490
GGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK    491 - 560
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAF    561 - 630
WIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGT    631 - 700
LAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAE    701 - 770
EVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGL    771 - 840
TREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILK    841 - 910
QKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGE    911 - 980
ALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV                              981 - 1024
//

Text Mined References (38)

PMID Year Title