Property Summary

NCBI Gene PubMed Count 47
Grant Count 64
R01 Count 26
Funding $6,386,698.22
PubMed Score 125.58
PubTator Score 109.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99574 A8K217 D3DNP1 Q6AHZ4
Symbols PI12
neuroserpin

Gene

PDB

3F02   3F5N   3FGQ  

Gene RIF (34)

PMID Text
26367528 This C-terminal lability is not required for neuroserpin polymerisation in the endoplasmic reticulum, but the additional glycan facilitates degradation of the mutant protein during proteasomal impairment.
26329378 The thermal and chemical stability along with the polymerisation propensity of both Wild Type and Glu289Ala NS were characterized.
26176694 the protective effect of neuroserpin maybe independent from its canonical interaction with a tissue-type plasminogen activator
25670787 Neuroserpin is expressed in naive effector memory and central memory CD4 and CD8 T cell subsets, and monocytes, B cells, and NK cells. T-cell activation caused its translocation to the immunologic synapse, secretion, and delayed downregulation.
25450507 Molecular Dynamics simulations suggest that Neuroserpin conformational stability and flexibility arise from a spatial distribution of intramolecular salt-bridges and hydrogen bonds.
24036060 Alzheimer's disease brain tissues with elevated neuroserpin protein also showed increased expression of THRbeta1 and HuD
21961602 the origins of conformational lability
21569344 Neuroprotective properties of neuroserpin may be related to the inhibition of excitotoxicity, inflammation, as well as blood brain barrier disruption that occur after acute ischemic stroke.
21507957 Hrd1 and gp78 mediate mutant neuroserpin turnover through the ERAD pathway.
21487809 our study did not provide any evidence for an association between genetic variation at the SERPINI1 locus and ischemic stroke
More...

AA Sequence

MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQK      1 - 70
EIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVD     71 - 140
FSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDES    141 - 210
EVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWA    211 - 280
NSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSE    281 - 350
AAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL              351 - 410
//

Text Mined References (49)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26367528 2015 Interactions between N-linked glycosylation and polymerisation of neuroserpin within the endoplasmic reticulum.
26329378 2015 The stability and activity of human neuroserpin are modulated by a salt bridge that stabilises the reactive centre loop.
26176694 2015 Retina Is Protected by Neuroserpin from Ischemic/Reperfusion-Induced Injury Independent of Tissue-Type Plasminogen Activator.
25670787 2015 Human T cell activation induces synaptic translocation and alters expression of the serine protease inhibitor neuroserpin and its target protease.
25450507 2015 Functional and dysfunctional conformers of human neuroserpin characterized by optical spectroscopies and Molecular Dynamics.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24036060 2013 Neuroserpin up-regulation in the Alzheimer's disease brain is associated with elevated thyroid hormone receptor-?1 and HuD expression.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...