Property Summary

NCBI Gene PubMed Count 53
PubMed Score 129.51
PubTator Score 109.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 4.169 2.1
Disease Target Count Z-score Confidence
Cerebrovascular disease 238 3.27 1.6
Disease Target Count
progressive myoclonus epilepsy 12

Expression

  Differential Expression (34)

Disease log2 FC p
adult high grade glioma -4.100 1.6e-05
aldosterone-producing adenoma -1.136 8.1e-03
Alzheimer's disease -1.300 3.2e-02
astrocytic glioma -3.600 1.1e-02
Astrocytoma, Pilocytic -3.400 1.3e-09
atypical teratoid / rhabdoid tumor -2.600 1.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.124 8.8e-03
cystic fibrosis 1.045 7.1e-05
Duchenne muscular dystrophy 1.031 2.6e-06
ependymoma -4.400 5.8e-03
gastric carcinoma -1.700 2.9e-02
glioblastoma -3.700 4.4e-07
group 3 medulloblastoma -2.600 4.9e-03
interstitial cystitis 1.300 1.1e-03
intraductal papillary-mucinous adenoma (... -3.600 8.7e-05
intraductal papillary-mucinous carcinoma... -3.500 5.9e-03
intraductal papillary-mucinous neoplasm ... -3.400 2.7e-03
juvenile dermatomyositis 1.139 3.4e-10
lung cancer 5.000 4.4e-07
lung carcinoma 2.700 1.5e-28
malignant mesothelioma -1.500 6.6e-06
medulloblastoma, large-cell -5.400 3.9e-06
oligodendroglioma -2.700 1.2e-02
ovarian cancer -1.600 2.1e-04
pancreatic cancer -1.400 5.1e-05
periodontitis 1.100 4.7e-23
Pick disease -2.300 6.4e-03
pituitary cancer 1.200 1.1e-02
primary pancreatic ductal adenocarcinoma -1.532 1.9e-04
primitive neuroectodermal tumor -3.000 1.3e-03
psoriasis -1.100 4.6e-07
subependymal giant cell astrocytoma -3.756 1.8e-02
tuberculosis 1.300 8.8e-04
ulcerative colitis 1.400 1.3e-03

Gene RIF (37)

AA Sequence

MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQK      1 - 70
EIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVD     71 - 140
FSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDES    141 - 210
EVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWA    211 - 280
NSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSE    281 - 350
AAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL              351 - 410
//

Text Mined References (56)

PMID Year Title