Property Summary

NCBI Gene PubMed Count 68
Grant Count 323
R01 Count 207
Funding $41,394,434.04
PubMed Score 291.66
PubTator Score 136.93

Knowledge Summary

Patent (21,420)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
esophageal adenocarcinoma 1.100 0.018
glioblastoma 1.100 0.029
intraductal papillary-mucinous neoplasm ... -1.200 0.005
acute myeloid leukemia 1.200 0.025
ulcerative colitis -1.300 0.000

Synonym

Accession Q99571 E7EPF7 F6RU17 O00450 O14722 Q5U089 Q5U090 Q8N4N1 Q9UBG9 P2X4
Symbols P2X4
P2X4R

Gene

  TechDev Info (1)

Susumu Tomita Examining potential modulators

Gene RIF (50)

PMID Text
26946358 The results suggest a role of PrP(C) in proteostasis, dysfunctions of which may be involved in the pathogenesis of neurodegenerative diseases such as TSE and Alzheimer's Disease.
26865631 These findings provide new insights in understanding the contribution of the salt bridge between Asp-85 and Arg-309 and its structurally coupled beta2,3-sheet to the function of P2X4 receptors.
26101220 P2X4 and calmodulin form a complex at endolysosomal membrane where P2X4 activation recruits calmodulin to promote fusion and vacuolation in a Ca(2+)-dependent fashion.
25938443 Fndings support role for P2X7 and P2X4 coupled to induction of inflammatory molecules in modulating high glucose and palmitate-induced endothelial cell activation and dysfunction.
25563726 This study demonstrates a major physiological finding that the shear-induced effects on endothelial KLF2 axis are in part dependent on ATP release and P2X4, a previously unidentified mechanism.
25480524 It appears to mediate the cells' response to extracellular ATP. Although Ca2thorn influx via P2X1 receptor is necessary for alpha-synuclein accumulation.
24935743 Using pHluorin, P2X4 was found to be expressed on the plasma membrane and within subcellular compartments in hippocampus.
24845338 These data suggest that vascular smooth muscle cells from human gastro-omental arteries express P2X1 and P2X4 receptor subunits
24817123 the lysosome-localized P2X4 may play specific roles in membrane trafficking of acidic organelles in mammalian cells.
23959888 Data indicate that MgATP2- activates P2X1 and P2X3, but not P2X2 and P2X4 receptors.
More...

AA Sequence

MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKG      1 - 70
VAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTH     71 - 140
SNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNIT    141 - 210
TTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLD    211 - 280
TRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMAT    281 - 350
VLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ                                    351 - 388
//

Text Mined References (71)

PMID Year Title
26946358 2016 The prion protein selectively binds to and modulates the content of purinergic receptor P2X4R.
26865631 2016 A Highly Conserved Salt Bridge Stabilizes the Kinked Conformation of ?2,3-Sheet Essential for Channel Function of P2X4 Receptors.
26101220 2015 Calcium release through P2X4 activates calmodulin to promote endolysosomal membrane fusion.
25938443 2015 The ATP Receptors P2X7 and P2X4 Modulate High Glucose and Palmitate-Induced Inflammatory Responses in Endothelial Cells.
25563726 2015 Shear stress modulates endothelial KLF2 through activation of P2X4.
25480524 2015 Extracellular ATP induces intracellular alpha-synuclein accumulation via P2X1 receptor-mediated lysosomal dysfunction.
25416956 2014 A proteome-scale map of the human interactome network.
24935743 2014 Imaging P2X4 receptor subcellular distribution, trafficking, and regulation using P2X4-pHluorin.
24845338 2014 Vascular smooth muscle cells from small human omental arteries express P2X1 and P2X4 receptor subunits.
24817123 2014 P2X4 forms functional ATP-activated cation channels on lysosomal membranes regulated by luminal pH.
More...