Property Summary

NCBI Gene PubMed Count 20
Grant Count 22
R01 Count 16
Funding $927,485.37
PubMed Score 26.07
PubTator Score 10.38

Knowledge Summary

Patent (11,371)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ovarian cancer 1.800 0.003

Gene RIF (3)

PMID Text
25840748 High expression of PI3K core complex genes is associated with poor prognosis in chronic lymphocytic leukemia.
20643123 A specific sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates both receptor degradation and cytokinesis, whereas ATG14L, a PI3K-III subunit involved in autophagy, is not required.
18957027 hVps15, but not Ca2+/CaM, is required for the activity and regulation of hVps34 in mammalian cells

AA Sequence

MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQE      1 - 70
LEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAH     71 - 140
KSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFAT    141 - 210
ELEYMRDPSTPLVDLNSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNK    211 - 280
IEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDL    281 - 350
GNIIHNLCGHDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITP    351 - 420
YLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLA    421 - 490
ETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQKVVTLLSDPENIVKQTLMENG    491 - 560
ITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEF    561 - 630
VIVKALYALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLD    631 - 700
PYITQPIIQIERKLVLLSVLKEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQL    701 - 770
LKKLLSQGMTEEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP    771 - 840
DDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICVPLSTSSQVPE    841 - 910
VTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWR    911 - 980
PKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTF    981 - 1050
CQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGS   1051 - 1120
LVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRL   1121 - 1190
SMHPLYQSWVIAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG   1191 - 1260
SDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHD   1261 - 1330
IITDVATFQTTQGFIVTASRDGIVKVWK                                             1331 - 1358
//

Text Mined References (30)

PMID Year Title
25840748 2015 High expression of PI3K core complex genes is associated with poor prognosis in chronic lymphocytic leukemia.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24849286 2014 NRBF2 regulates autophagy and prevents liver injury by modulating Atg14L-linked phosphatidylinositol-3 kinase III activity.
24785657 2014 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
23878393 2013 Role of membrane association and Atg14-dependent phosphorylation in beclin-1-mediated autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21062745 2011 The RUN domain of rubicon is important for hVps34 binding, lipid kinase inhibition, and autophagy suppression.
20643123 2010 A phosphatidylinositol 3-kinase class III sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates cytokinesis and degradative endocytic traffic.
More...