Property Summary

NCBI Gene PubMed Count 38
PubMed Score 19.48
PubTator Score 25.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (32)

Disease log2 FC p
lung cancer 1.200 7.5e-03
acute myeloid leukemia 1.200 3.4e-02
adult high grade glioma -2.200 6.7e-05
astrocytic glioma -2.500 1.3e-03
Astrocytoma, Pilocytic -1.400 1.9e-04
atypical teratoid / rhabdoid tumor -1.300 1.0e-04
Breast cancer -1.300 3.2e-07
colon cancer 1.100 2.1e-02
cystic fibrosis -1.258 3.2e-03
Down syndrome 1.300 1.1e-02
ependymoma -3.100 8.6e-04
glioblastoma -1.800 1.4e-06
group 3 medulloblastoma -1.700 5.9e-03
hepatocellular carcinoma -1.100 2.7e-02
intraductal papillary-mucinous adenoma (... 1.800 4.2e-03
intraductal papillary-mucinous carcinoma... 1.200 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.900 3.2e-03
lung adenocarcinoma 1.147 1.6e-05
malignant mesothelioma 1.600 1.7e-07
medulloblastoma, large-cell -2.800 2.9e-05
nasopharyngeal carcinoma 1.400 5.2e-03
non primary Sjogren syndrome sicca -1.200 2.0e-02
oligodendroglioma -1.800 8.7e-03
osteosarcoma -1.897 5.4e-05
ovarian cancer -2.200 1.0e-07
Pick disease -1.600 3.4e-02
primitive neuroectodermal tumor -2.900 3.7e-04
psoriasis -1.700 2.4e-04
Rheumatoid arthritis 1.300 2.7e-02
severe Alzheimer's disease -1.075 3.7e-02
spina bifida -1.115 4.1e-02
subependymal giant cell astrocytoma -2.042 1.4e-03

Gene RIF (18)

AA Sequence

MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCR      1 - 70
LGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQPNNYLIRTEPEQGTLYSPEQTSLHESEGSL     71 - 140
GNSRSSTQMNSYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMR    141 - 210
RVSSVPSRAQSPSYVISTGVSPSRGSLRTSLGSGFGSPSVTDPRPLNPSAYSSTTLPAARAASPYSQRPA    211 - 280
SPTAIRRIGSVTSRQTSNPNGPTPQYQTTARVGSPLTLTDAQTRVASPSQGQVGSSSPKRSGMTAVPQHL    281 - 350
GPSLQRTVHDMEQFGQQQYDIYERMVPPRPDSLTGLRSSYASQHSQLGQDLRSAVSPDLHITPIYEGRTY    351 - 420
YSPVYRSPNHGTVELQGSQTALYRTGSVGIGNLQRTSSQRSTLTYQRNNYALNTTATYAEPYRPIQYRVQ    421 - 490
ECNYNRLQHAVPADDGTTRSPSIDSIQKDPREFAWRDPELPEVIHMLQHQFPSVQANAAAYLQHLCFGDN    491 - 560
KVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLRKSIDAE    561 - 630
VRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKIKFQTSLVLRNTTGCLRNL    631 - 700
SSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELDD    701 - 770
LLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNP    771 - 840
ATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIG    841 - 910
KYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGRGDRSSLKV    911 - 980
VKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSP    981 - 1050
ALLGIRDPRSEYDRTQPPMQYYNSQGDATHKGLYPGSSKPSPIYISSYSSPAREQNRRLQHQQLYYSQDD   1051 - 1120
SNRKNFDAYRLYLQSPHSYEDPYFDDRVHFPASTDYSTQYGLKSTTNYVDFYSTKRPSYRAEQYPGSPDS   1121 - 1190
WV                                                                       1191 - 1192
//

Text Mined References (52)

PMID Year Title