Property Summary

NCBI Gene PubMed Count 35
Grant Count 3
Funding $87,281.33
PubMed Score 30.67
PubTator Score 35.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.563 0.000
group 3 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.200 0.001
primitive neuroectodermal tumor 1.200 0.001
juvenile dermatomyositis 1.059 0.000
acute quadriplegic myopathy 1.392 0.000
lung cancer 1.500 0.009
Breast cancer -1.100 0.000
ovarian cancer 2.800 0.000
dermatomyositis 1.400 0.002

Synonym

Accession Q99567 D3DTM2 Q9BWE5
Symbols

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (17)

PMID Text
26731471 These findings demonstrate that the NUP88-NUP98-RAE1-APC/CCDH1 axis contributes to aneuploidy
23777819 Nup62 and Nup88 protein levels were significantly decreased upon knockdown of O-GlcNAc transferase.
21896994 Nup88 mRNA was overexpressed in colorectal cancers and the overexpression was associated with cancer development and aggressiveness.
21863385 Serum Nup88 might be a candidate for a new biomarker implicated in the development and aggressiveness of colorectal cancer
21289091 Data suggest that a pool of Nup88 on the nuclear side of the nuclear pore complex provides a novel, unexpected binding site for nuclear lamin A.
20973273 association found between myometrial invasion and Nup88 expression in endometrial carcinoma
20497554 proper expression of Nup88 is critical for preventing aneuploidy formation and tumorigenesis.
19751906 Nup88 is significantly overexpressed in high-grade CIN lesions and ISCC compared with normal ectocervical squamous epithelia and CIN1.
19454010 Interaction of HIV-1 Tat with Nup88 in T-cells is identified by a proteomic strategy based on affinity chromatography
18606815 Nup88 is up-regulated in response to hypertonic stress and acts to retain TonEBP in the nucleus, activating transcription of critical osmoprotective genes.
More...

AA Sequence

MAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRNVVFGLGGELFL      1 - 70
WDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMVLELPKRW     71 - 140
GKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYPSEILDPHVVLLTSDNVIRIYSLREPQTPTN    141 - 210
VIILSEAEEESLVLNKGRAYTASLGETAVAFDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTY    211 - 280
ISLLHSPGNIGKLLGPLPMHPAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSE    281 - 350
KSWDSRIDLIPSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLTW    351 - 420
IHKLHKFLGSDEEDKDSLQELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL    421 - 490
IWPLLSTVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEE    491 - 560
CLQLLSRATQVFREQYILKQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAERLADKYEEAK    561 - 630
EKQEDIMNRMKKLLHSFHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLP    631 - 700
KPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVNF                                 701 - 741
//

Text Mined References (45)

PMID Year Title
26731471 2016 Nuclear pore protein NUP88 activates anaphase-promoting complex to promote aneuploidy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23777819 2013 Quantitative regulation of nuclear pore complex proteins by O-GlcNAcylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21896994 Nup88 mRNA overexpression in colorectal cancers and relationship with p53.
21863385 2012 Increased serum level of Nup88 protein is associated with the development of colorectal cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21289091 2011 The nucleoporin Nup88 is interacting with nuclear lamin A.
21269460 2011 Initial characterization of the human central proteome.
More...