Property Summary

NCBI Gene PubMed Count 37
PubMed Score 30.40
PubTator Score 35.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.392 1.4e-07
Breast cancer -1.100 4.7e-23
dermatomyositis 1.400 1.5e-03
group 3 medulloblastoma 1.800 1.7e-05
juvenile dermatomyositis 1.059 6.2e-07
lung cancer 1.500 9.1e-03
medulloblastoma, large-cell 1.200 5.2e-04
osteosarcoma -1.563 9.2e-06
ovarian cancer 2.800 2.8e-06
primitive neuroectodermal tumor 1.200 7.6e-04

 GO Function (1)

Protein-protein Interaction (6)

Gene RIF (19)

AA Sequence

MAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRNVVFGLGGELFL      1 - 70
WDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMVLELPKRW     71 - 140
GKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYPSEILDPHVVLLTSDNVIRIYSLREPQTPTN    141 - 210
VIILSEAEEESLVLNKGRAYTASLGETAVAFDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTY    211 - 280
ISLLHSPGNIGKLLGPLPMHPAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSE    281 - 350
KSWDSRIDLIPSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLTW    351 - 420
IHKLHKFLGSDEEDKDSLQELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL    421 - 490
IWPLLSTVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEE    491 - 560
CLQLLSRATQVFREQYILKQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAERLADKYEEAK    561 - 630
EKQEDIMNRMKKLLHSFHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLP    631 - 700
KPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVNF                                 701 - 741
//

Text Mined References (47)

PMID Year Title