Property Summary

NCBI Gene PubMed Count 107
PubMed Score 0.00
PubTator Score 127.96

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.08114485064798E-14
malignant mesothelioma 3163 2.4039978135129E-7
Atopic dermatitis 944 9.15318013592368E-5


  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
Atopic dermatitis 1.200 0.000
non-small cell lung cancer -1.104 0.000


Accession Q99558 A8K2D8 D3DX67 Q8IYN1
Symbols HS



4DN5   4G3D   4IDT   4IDV  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (57)

26823811 NIK expression was significantly increased in the tumor tissue of patients with breast carcinoma, which may be an important factor that affects the prognosis of these patients.
26602079 Data suggest microRNA302c, but not microRNA520e, promotes replication of influenza A virus H3N2 although the two microRNAs target same site of NFkappaB-inducing kinase (MAP3K14) 3prime untranslated region; studies were conducted in lung epithelial cells.
26498133 This study identified two novel independent loci (MAP3K14 and CARD9) strongly associated with joint damage in Mexican Americans and European Americans and a few shared loci showing suggestive evidence for association.
26269411 The forced expression of NDRG2 in ATL cells down-regulates not only the canonical pathway by inhibiting AKT signaling but also the non-canonical pathway by inducing NF-kappaB-inducing kinase (NIK) dephosphorylation via the recruitment of PP2A
26195760 Membrane attack complexes activate noncanonical NF-kappaB by forming a novel Akt(+)NIK(+) signalosome on Rab5(+) endosomes.
26178280 NIK(+) endothelial cells may play an important role in the persistence of synovitis
25766331 by demonstrating a critical role of NIK in mediating NF-kappaB activation and BAG3 induction upon ST80/Bortezomib cotreatment, our study provides novel insights into mechanisms of resistance to proteotoxic stress in RMS
25622756 TWEAK induces noncanonical NF-kappaB signaling and signal-specific regulation of NIK mRNA expression.
25406581 Loss-of-function mutations in NIK can cause B-cell lymphopenia, hypogammaglobulinemia, impaired ICOSL expression, and disordered T helper cell and NK cell function.
25246529 Identification and function of the NIK IAP binding motif, which promotes c-IAP1-dependent ubiquitylation of NIK.

AA Sequence

YDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP                                     911 - 947

Text Mined References (112)

PMID Year Title
26823811 2015 Expression of NF-?B-inducing kinase in breast carcinoma tissue and its clinical significance.
26602079 2015 Mir-302c mediates influenza A virus-induced IFN? expression by targeting NF-?B inducing kinase.
26498133 2015 Genetic Variants Influencing Joint Damage in Mexican Americans and European Americans With Rheumatoid Arthritis.
26269411 2015 Loss of NDRG2 enhanced activation of the NF-?B pathway by PTEN and NIK phosphorylation for ATL and other cancer development.
26195760 2015 Complement membrane attack complexes activate noncanonical NF-?B by forming an Akt+ NIK+ signalosome on Rab5+ endosomes.
26178280 2015 Nuclear Factor-?B-inducing Kinase Is Expressed in Synovial Endothelial Cells in Patients with Early Arthritis and Correlates with Markers of Inflammation: A Prospective Cohort Study.
25766331 2015 NIK is required for NF-?B-mediated induction of BAG3 upon inhibition of constitutive protein degradation pathways.
25622756 2015 Tumor necrosis factor-like weak inducer of apoptosis (TWEAK) promotes glioma cell invasion through induction of NF-?B-inducing kinase (NIK) and noncanonical NF-?B signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25406581 2014 Biallelic loss-of-function mutation in NIK causes a primary immunodeficiency with multifaceted aberrant lymphoid immunity.