Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.35
PubTator Score 5.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.255 5.7e-04
astrocytic glioma 1.400 3.1e-03
atypical teratoid / rhabdoid tumor -1.300 9.0e-04
Breast cancer 1.400 2.3e-16
diabetes mellitus -1.100 1.4e-03
ependymoma 1.200 9.0e-03
glioblastoma 1.200 6.5e-09
group 3 medulloblastoma 1.200 3.9e-03
interstitial cystitis 1.300 2.7e-03
lung cancer 1.300 4.2e-03
lung carcinoma 1.400 7.6e-28
medulloblastoma, large-cell 1.600 8.9e-05
non-small cell lung cancer 1.260 1.4e-21
oligodendroglioma 1.200 2.3e-02
osteosarcoma 1.428 3.5e-02
pediatric high grade glioma 1.200 3.9e-06
primitive neuroectodermal tumor 1.500 1.6e-05

Gene RIF (6)

AA Sequence

MEEFDLVKTLHKTSSSVGSDENSLHSLGLNLNTDRSSPHLSTNGVSSFSGKTRPSVIQGTVEVLTSLMQE      1 - 70
LQNSGKTDSELWKNCETRWLQLFNLVEKQCQEQIVAQQEQFHNQIQHIQEEIKNLVKLQTSSASLASCEG     71 - 140
NSSNKQVSSESQMGFFSLSSERNESVIHYPESTEPEIQQEMSTSQPDCNVDSCSVSSGYGTFCISELNLY    141 - 210
KSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENK    211 - 280
VSEVYSGKTNSNAITSWAQKLKQNQPKRAHVEDGGSRSKQGNEQSKKTPIEKSDFAAATHPRAFYLSKPD    281 - 350
ETPNAWMSDSGTGLTYWKLEEKDMHHSLPETLEKTFISLSSTDVSPNQSNTSNEMKLPSLKDIYYKKQRE    351 - 420
NKQLPERNLTSASNPNHPPEVLTLDPTLHMKPKQQISGIQPHGLPNALDDRISFSPDSVLEPSMSSPSDI    421 - 490
DSFSQASNVTSQLPGFPKYPSHTKASPVDSWKNQTFQNESRTSSTFPSVYTITSNDISVNTVDEENTVMV    491 - 560
ASASVSQSQLPGTANSVPECISLTSLEDPVILSKIRQNLKEKHARHIADLRAYYESEINSLKQKLEAKEI    561 - 630
SGVEDWKITNQILVDRCGQLDSALHEATSRVRTLENKNNLLEIEVNDLRERFSAASSASKILQERIEEMR    631 - 700
TSSKEKDNTIIRLKSRLQDLEEAFENAYKLSDDKEAQLKQENKMFQDLLGEYESLGKEHRRVKDALNTTE    701 - 770
NKLLDAYTQISDLKRMISKLEAQVKQVEHENMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSI    771 - 840
FTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRETSDTPIMRALKELDEGKIFKN    841 - 910
WGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLPPSNRKSSTPTKREIMLTPVT    911 - 980
VAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDTVPVSTLQRTNPRKQLQFLPLDDSEEKTYSE    981 - 1050
KATDNHVNHSSCPEPVPNGVKKVSVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDE   1051 - 1120
LTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL          1121 - 1183
//

Text Mined References (23)

PMID Year Title