Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.71
PubTator Score 5.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.400 0.003
ependymoma 1.200 0.009
oligodendroglioma 1.500 0.007
osteosarcoma 1.428 0.035
glioblastoma 1.400 0.000
sonic hedgehog group medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.500 0.000
adrenocortical carcinoma 1.255 0.001
non-small cell lung cancer 1.260 0.000
lung cancer 2.300 0.000
diabetes mellitus -1.100 0.001
interstitial cystitis 1.300 0.003
pediatric high grade glioma 1.200 0.000
lung carcinoma 1.400 0.000
Breast cancer 1.400 0.000

Synonym

Accession Q99550 A1L486 A6NEE2 B3KR87 Q9H976 U3KQ28
Symbols MPP9
MPP-9

Gene

Gene RIF (6)

PMID Text
26362536 HIV-1 Gag interacts with MPHOSPH9 as demonstrated by proximity dependent biotinylation proteomics
24130709 The MPHOSPH9 polymorphism was associated with greater attack severity in Multiple sclerosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546594 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MEEFDLVKTLHKTSSSVGSDENSLHSLGLNLNTDRSSPHLSTNGVSSFSGKTRPSVIQGTVEVLTSLMQE      1 - 70
LQNSGKTDSELWKNCETRWLQLFNLVEKQCQEQIVAQQEQFHNQIQHIQEEIKNLVKLQTSSASLASCEG     71 - 140
NSSNKQVSSESQMGFFSLSSERNESVIHYPESTEPEIQQEMSTSQPDCNVDSCSVSSGYGTFCISELNLY    141 - 210
KSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENK    211 - 280
VSEVYSGKTNSNAITSWAQKLKQNQPKRAHVEDGGSRSKQGNEQSKKTPIEKSDFAAATHPRAFYLSKPD    281 - 350
ETPNAWMSDSGTGLTYWKLEEKDMHHSLPETLEKTFISLSSTDVSPNQSNTSNEMKLPSLKDIYYKKQRE    351 - 420
NKQLPERNLTSASNPNHPPEVLTLDPTLHMKPKQQISGIQPHGLPNALDDRISFSPDSVLEPSMSSPSDI    421 - 490
DSFSQASNVTSQLPGFPKYPSHTKASPVDSWKNQTFQNESRTSSTFPSVYTITSNDISVNTVDEENTVMV    491 - 560
ASASVSQSQLPGTANSVPECISLTSLEDPVILSKIRQNLKEKHARHIADLRAYYESEINSLKQKLEAKEI    561 - 630
SGVEDWKITNQILVDRCGQLDSALHEATSRVRTLENKNNLLEIEVNDLRERFSAASSASKILQERIEEMR    631 - 700
TSSKEKDNTIIRLKSRLQDLEEAFENAYKLSDDKEAQLKQENKMFQDLLGEYESLGKEHRRVKDALNTTE    701 - 770
NKLLDAYTQISDLKRMISKLEAQVKQVEHENMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSI    771 - 840
FTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRETSDTPIMRALKELDEGKIFKN    841 - 910
WGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLPPSNRKSSTPTKREIMLTPVT    911 - 980
VAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDTVPVSTLQRTNPRKQLQFLPLDDSEEKTYSE    981 - 1050
KATDNHVNHSSCPEPVPNGVKKVSVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDE   1051 - 1120
LTKEKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL          1121 - 1183
//

Text Mined References (23)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23644468 2013 CEP162 is an axoneme-recognition protein promoting ciliary transition zone assembly at the cilia base.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20546594 2010 An application of Random Forests to a genome-wide association dataset: methodological considerations & new findings.
More...