Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
R01 Count 2
Funding $139,855.2
PubMed Score 14.46
PubTator Score 12.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -1.687 0.000
glioblastoma -1.300 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.005
aldosterone-producing adenoma -1.138 0.040
ovarian cancer -2.600 0.000

Synonym

Accession Q99549 B7Z6F9 Q5JPE5 Q5JTQ0 Q86TK3 Q96MK4 Q9BTP1
Symbols TWA3
mpp8
HSMPP8

Gene

 Grant Application (2)

PDB

3SVM   3QO2   3R93   3LWE  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
488946 summary 0 / 0 / 0 Probe Summary Assay for Inhibitors for MPP8 Chromodomain Interactions with Methylated Histone Tails
488949 confirmatory 195 / 256 / 2109 qHTS Validation Assay for Inhibitors for MPP8 Chromodomain Interactions with Methylated Histone Tails

Gene RIF (8)

PMID Text
26022416 this study identified the HUSH (human silencing hub) complex, comprising three poorly characterized proteins, TASOR, MPP8, and periphilin; this complex is absent from Drosophila but is conserved from fish to humans.
25870236 findings demonstrate MPP8 and SIRT1 reciprocally regulate each other's function at multiple molecular layers through physical interaction; disruption of MPP8-SIRT1 interaction de-represses E cadherin expression and reduces cell motility and invasiveness suggesting this interplay plays critical role in MPP8- and SIRT1-mediated epithelial-mesenchymal transition
25660450 Knockdown analysis of MPP8 in HeLa cells resulted in derepression of a set of genes that are normally expressed in spermatogonia, spermatids and mature sperm, thereby indicating a role for this molecule in silencing testis-related genes in somatic cells.
23532874 interaction of HN with MPP8 may play a role in oncogenesis because MPP8 increases tumor cell motility and invasion
23416073 these results indicate that the chromatin association of MPP8 is regulated by Cdk-dependent phosphorylation.
22022377 These findings reveal the molecular mechanism of selective binding of human MPP8 chromodomain to methylated histone H3K9.
21419134 We determined the crystal structure of MPP8 chromodomain in complex with H3K9me3 peptide. MPP8 interacts with at least six histone H3 residues from glutamine 5 to serine 10.
20871592 MPP8 mediates E-cadherin gene silencing and promotes breast tumour cell motility and invasion.

AA Sequence

MEQVAEGARVTAVPVSAADSTEELAEVEEGVGVVGEDNDAAARGAEAFGDSEEDGEDVFEVEKILDMKTE      1 - 70
GGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVRKDIQRLSLNNDIFEANSDSDQ     71 - 140
QSETKEDTSPKKKKKKLRQREEKSPDDLKKKKAKAGKLKDKSKPDLESSLESLVFDLRTKKRISEAKEEL    141 - 210
KESKKPKKDEVKETKELKKVKKGEIRDLKTKTREDPKENRKTKKEKFVESQVESESSVLNDSPFPEDDSE    211 - 280
GLHSDSREEKQNTKSARERAGQDMGLEHGFEKPLDSAMSAEEDTDVRGRRKKKTPRKAEDTRENRKLENK    281 - 350
NAFLEKKTVPKKQRNQDRSKSAAELEKLMPVSAQTPKGRRLSGEERGLWSTDSAEEDKETKRNESKEKYQ    351 - 420
KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSL    421 - 490
KERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQLEWMKLEDFQKHLDGKDENFA    491 - 560
ATDAIPSNVLRDAVKNGDYITVKVALNSNEEYNLDQEDSSGMTLVMLAAAGGQDDLLRLLITKGAKVNGR    561 - 630
QKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQ    631 - 700
NSALHFAKQSNNVLVYDLLKNHLETLSRVAEETIKDYFEARLALLEPVFPIACHRLCEGPDFSTDFNYKP    701 - 770
PQNIPEGSGILLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRL    771 - 840
TEAPSAKVKLLIGAYRVQLQ                                                      841 - 860
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26022416 2015 GENE SILENCING. Epigenetic silencing by the HUSH complex mediates position-effect variegation in human cells.
25870236 2015 MPP8 and SIRT1 crosstalk in E-cadherin gene silencing and epithelial-mesenchymal transition.
25660450 2015 Physical interaction between MPP8 and PRC1 complex and its implication for regulation of spermatogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23532874 2013 Humanin binds MPP8: mapping interaction sites of the peptide and protein.
23416073 2013 Mitotic phosphorylation of MPP8 by cyclin-dependent kinases regulates chromatin dissociation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...