Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.31
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma -1.400 0.000
psoriasis 2.000 0.000
osteosarcoma -1.242 0.029
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.002
intraductal papillary-mucinous neoplasm ... 1.500 0.004
lung cancer 1.600 0.000
ductal carcinoma in situ 1.600 0.004
invasive ductal carcinoma 1.100 0.017
ovarian cancer -1.400 0.000

Synonym

Accession Q99547 B2RAF0
Symbols MPP
MPP6
MPP-6

Gene

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of M-phase phosphoprotein 6 (MPHOSPH6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16396833 MPP6 is a nucleolus-specific exosome co-factor required for its role in the maturation of 5.8S rRNA.
11719186 MPP6 was found to be associated with the exosome, a multiprotein complex involved in RNA degradation.

AA Sequence

MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDL      1 - 70
LYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEE     71 - 140
DENGDITPIKAKKMFLKPQD                                                      141 - 160
//

Text Mined References (27)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
20531386 2010 The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...