Property Summary

NCBI Gene PubMed Count 60
PubMed Score 72.57
PubTator Score 69.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Spontaneous abortion 108
Disease Target Count P-value
non-small cell lung cancer 2798 3.01948438277746E-16
osteosarcoma 7933 2.82954290290778E-12
lung carcinoma 2844 2.08185181468048E-11
tuberculosis 1563 4.34683448966618E-9
malignant mesothelioma 3163 5.03123161063069E-8
pilocytic astrocytoma 3086 2.41623675169536E-7
lung cancer 4473 4.19411892001947E-7
psoriasis 6685 2.10490122381928E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.94213870079444E-5
posterior fossa group A ependymoma 1511 8.57670306085174E-5
Breast cancer 3099 1.39354045994203E-4
atypical teratoid / rhabdoid tumor 4369 1.44135926699601E-4
pediatric high grade glioma 2712 2.05816973007048E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.3831369736244E-4
ulcerative colitis 2087 9.9552848829953E-4
glioblastoma 5572 0.00148452570480076
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00176426343940364
lung adenocarcinoma 2714 0.00430382541207018
cutaneous lupus erythematosus 1056 0.00437868510484391
gastric carcinoma 832 0.044392118114172
Disease Target Count
Cavitary optic disc anomalies 1

Expression

Synonym

Accession Q99542 B4E030 O15278 O95606 Q99580 MMP-19
Symbols CODA
MMP18
RASI-1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (26)

PMID Text
26548962 the downregulation of MMP19 following respiratory syncytial virus infection may be associated with the development of airway hyperresponsiveness.
26292259 Loss of NDRG2 induced the expression of matrix metalloproteinase-19 (MMP-19), which regulated the expression of Slug at the transcriptional level in the epithelial-mesenchymal transition of gallbladder carcinoma cells.
25840998 the intima+media of IPAH vessels, collagens (COL4A5, COL14A1, and COL18A1), matrix metalloproteinase (MMP) 19, and a disintegrin and metalloprotease (ADAM) 33 were higher expressed, whereas MMP10, ADAM17, TIMP1, and TIMP3 were less abundant.
25581579 Triplication of an enhancer may lead to overexpression of MMP19 in the optic nerve that causes cavitary optic disc anomaly.
25250855 Matrix metalloproteinase-19 in lung epithelial cells stimulates proliferation and cell migration. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201310-1903OC
25056434 The expression of MMP-19 in the main forms of gastrointestinal diseases, was analysed.
23956056 ASNS and MMP19, along with eIF3a, are the sensitivity factors for cisplatin treatment and may serve as potential candidate molecular markers for predicting cisplatin sensitivity of advanced nasopharyngeal carcinoma.
22859522 Up-regulation of matrix metalloproteinase-19 (MMP19) induced by lung injury may play a protective role in the development of fibrosis through the induction of prostaglandin-endoperoxide synthase 2 (PTGS2).
22855183 These findings indicated for the first time that the co-expression of MMP-14 and MMP-19 is significantly correlated with prognosis in glioma patients
22576687 MMP-15 and MMP-19 are upregulated during colorectal tumorigenesis
More...

AA Sequence

MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSG      1 - 70
QLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVA     71 - 140
PLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIA    141 - 210
AHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPT    211 - 280
EPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIH    281 - 350
FFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG    351 - 420
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSG    421 - 490
TGITLDTTLSATETTFEY                                                        491 - 508
//

Text Mined References (63)

PMID Year Title
26548962 2016 Downregulation of matrix metalloproteinase?19 induced by respiratory syncytial viral infection affects the interaction between epithelial cells and fibroblasts.
26292259 2015 Loss of NDRG2 promotes epithelial-mesenchymal transition of gallbladder carcinoma cells through MMP-19-mediated Slug expression.
25840998 2015 Compartment-specific expression of collagens and their processing enzymes in intrapulmonary arteries of IPAH patients.
25581579 2015 Heterozygous triplication of upstream regulatory sequences leads to dysregulation of matrix metalloproteinase 19 in patients with cavitary optic disc anomaly.
25250855 2014 Matrix metalloproteinase-19 promotes metastatic behavior in vitro and is associated with increased mortality in non-small cell lung cancer.
25171405 2014 A secreted tyrosine kinase acts in the extracellular environment.
25056434 2014 Differential expression and processing of matrix metalloproteinase 19 marks progression of gastrointestinal diseases.
23956056 2013 Overexpression of asparagine synthetase and matrix metalloproteinase 19 confers cisplatin sensitivity in nasopharyngeal carcinoma cells.
22859522 2012 Matrix metalloproteinase-19 is a key regulator of lung fibrosis in mice and humans.
22855183 2013 Co-expression of MMP-14 and MMP-19 predicts poor survival in human glioma.
More...