Property Summary

NCBI Gene PubMed Count 62
PubMed Score 75.33
PubTator Score 69.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.300 1.1e-03
Astrocytoma, Pilocytic 2.400 5.4e-08
atypical teratoid / rhabdoid tumor 1.400 1.4e-04
Breast cancer -1.100 1.4e-04
cutaneous lupus erythematosus 1.100 4.4e-03
gastric carcinoma 2.100 4.4e-02
glioblastoma 1.200 2.7e-04
intraductal papillary-mucinous adenoma (... -1.100 3.4e-04
intraductal papillary-mucinous carcinoma... -1.600 3.9e-05
intraductal papillary-mucinous neoplasm ... -1.400 1.8e-03
lung adenocarcinoma -1.100 4.3e-03
lung cancer -1.300 6.9e-03
lung carcinoma -2.500 2.1e-11
malignant mesothelioma -3.500 5.0e-08
non-small cell lung cancer -2.095 3.0e-16
osteosarcoma -3.970 2.8e-12
posterior fossa group A ependymoma 1.100 8.6e-05
psoriasis -5.100 2.1e-06
tuberculosis -4.500 4.3e-09
ulcerative colitis 1.500 1.0e-03

Gene RIF (28)

AA Sequence

MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSG      1 - 70
QLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVA     71 - 140
PLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIA    141 - 210
AHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPT    211 - 280
EPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIH    281 - 350
FFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG    351 - 420
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSG    421 - 490
TGITLDTTLSATETTFEY                                                        491 - 508
//

Text Mined References (65)

PMID Year Title