Property Summary

NCBI Gene PubMed Count 67
Grant Count 182
R01 Count 113
Funding $22,479,639.23
PubMed Score 363.94
PubTator Score 226.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
psoriasis -1.300 0.000
glioblastoma 2.500 0.002
sonic hedgehog group medulloblastoma 1.400 0.003
atypical teratoid/rhabdoid tumor 1.700 0.000
adrenocortical carcinoma -1.230 0.023
tuberculosis -2.700 0.000
primary pancreatic ductal adenocarcinoma 1.200 0.042
non-small cell lung cancer -1.069 0.000
active Crohn's disease -1.060 0.007
pediatric high grade glioma 1.400 0.008
pilocytic astrocytoma 1.100 0.009
posterior fossa group A ependymoma 1.200 0.002
lung carcinoma -2.900 0.000
ovarian cancer -3.100 0.000
pituitary cancer -2.900 0.000
pancreatic cancer 1.100 0.028
dermatomyositis 1.400 0.001

Synonym

Accession Q99541 Q9BSC3
Symbols ADFP
ADRP

Gene

PANTHER Protein Class (1)

Gene RIF (58)

PMID Text
26742848 Conserved amphipathic helices mediate lipid droplet targeting of PLIN1, PLIN2, and PLIN3.
26731658 In hepatitis C virus -infected human livers, occludin and ADRP mRNA expression levels correlated with each other. Hepatitis C virus increases occludin expression via the upregulation of ADRP.
26636961 Adipophilin was present in 24 of 26 colorectal hyperplastic polyps, but did not correlate with presence of white opaque substance (i.e. lipid droplets) on magnifying endoscopy with narrow band imaging.
26598603 PLIN2 involves lipid modulation of GSK3 activity, GSK3 substrate expression, and cell growth/survival.
26181025 Results demonstrate the clinical utility, specificity, and sensitivity of urine AQP1 and PLIN2 to diagnose renal cell carcinoma.
26166692 PLIN2 inhibits insulininduced glucose uptake by activating NLRP3, caspase1 and IL1beta, leading to a decreased IRS1 expression.
25595097 Postprandial triglyceride rich lipoproteins may be involved in atherosclerotic plaque formation through the regulation of perilipin-2 and perilipin-3 proteins in macrophages.
25559404 Plin2 appears to be associated with functional alterations of the muscle
25279712 Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin.
25172666 Perilipin 2 binding to the lipid droplet surface requires both hydrophobic and electrostatic interactions.
More...

AA Sequence

MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSVAMTSALPIIQ      1 - 70
KLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDK     71 - 140
TKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDL    141 - 210
VQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDK    211 - 280
LYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMA    281 - 350
GDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGA    351 - 420
EMDKSSQETQRSEHKTH                                                         421 - 437
//

Text Mined References (72)

PMID Year Title
26742848 2016 Conserved Amphipathic Helices Mediate Lipid Droplet Targeting of Perilipins 1-3.
26731658 2016 Hepatitis C Virus Increases Occludin Expression via the Upregulation of Adipose Differentiation-Related Protein.
26728854 2016 PML isoform II plays a critical role in nuclear lipid droplet formation.
26636961 2016 Novel Endoscopic Findings as Visualized by Magnifying Endoscopy with Narrow-Band Imaging: White Opaque Substance Is Present in Colorectal Hyperplastic Polyps.
26598603 2015 Natural Functions of PLIN2 Mediating Wnt/LiCl Signaling and Glycogen Synthase Kinase 3 (GSK3)/GSK3 Substrate-Related Effects Are Modulated by Lipid.
26181025 2015 Evaluation of Urine Aquaporin-1 and Perilipin-2 Concentrations as Biomarkers to Screen for Renal Cell Carcinoma: A Prospective Cohort Study.
26166692 2015 PLIN2 inhibits insulin-induced glucose uptake in myoblasts through the activation of the NLRP3 inflammasome.
25595097 2015 Postprandial triglyceride-rich lipoproteins regulate perilipin-2 and perilipin-3 lipid-droplet-associated proteins in macrophages.
25559404 2015 Differential expression of perilipin 2 and 5 in human skeletal muscle during aging and their association with atrophy-related genes.
25279712 2014 Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin.
More...