Property Summary

NCBI Gene PubMed Count 45
Grant Count 30
R01 Count 27
Funding $2,641,788.93
PubMed Score 208.15
PubTator Score 69.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (29)

PMID Text
26802645 legumain might play an important role in cervical cancer cell migration and invasion.
26607955 Legumain appears to be involved in tumor development and deterioration.
26549211 AEP acts as a delta-secretase, cleaving APP at N373 and N585 residues, selectively influencing the amyloidogenic fragmentation of APP. AEP contributes to the age-dependent pathogenic mechanisms in Alzheimer disease.
26403494 Studies indicate that legumain, usually in lysosomes, is also found extracellularly and even translocates to the cytosol and the nucleus.
25605174 High legumain expression is associated with breast cancer.
25326800 AEP acts as a crucial mediator of tau-related clinical and neuropathological changes.
24742492 High legumain activity is associated with breast cancer.
24610907 Identified an alternative oncogenic pathway for TRAF6 that uses AEP as its substrate. AEP and TRAF6 protein levels may have prognostic implications in breast cancer patients. Thus, AEP may serve as a biomarker as well as new therapeutic target
24407422 This unique feature was confirmed by the crystal structure of AEPpH4.5 (AEP was matured at pH 4.5 and crystallized at pH 8.5), in which the broken peptide bonds were religated and the structure was transformed back to its proenzyme form.
24023813 the relationship among Legumain expression, clinicopathologic, biological variables and patient prognosis in gastric carcinoma
More...

AA Sequence

MVWKVAVFLSVALGIGAVPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMM      1 - 70
YDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDH     71 - 140
VFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAA    141 - 210
NPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKV    211 - 280
MQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVR    281 - 350
KIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHR    351 - 420
IKLSMDHVCLGHY                                                             421 - 433
//

Text Mined References (49)

PMID Year Title
26802645 2016 Knockdown of Legumain Suppresses Cervical Cancer Cell Migration and Invasion.
26607955 2015 Clinicopathologic significance of legumain overexpression in cancer: a systematic review and meta-analysis.
26549211 2015 Delta-secretase cleaves amyloid precursor protein and regulates the pathogenesis in Alzheimer's disease.
26403494 2016 Structure and function of legumain in health and disease.
25605174 2014 Legumain protein as a potential predictive biomarker for Asian patients with breast carcinoma.
25326800 2014 Cleavage of tau by asparagine endopeptidase mediates the neurofibrillary pathology in Alzheimer's disease.
24742492 2014 TBX2 represses CST6 resulting in uncontrolled legumain activity to sustain breast cancer proliferation: a novel cancer-selective target pathway with therapeutic opportunities.
24610907 2014 Functional role of asparaginyl endopeptidase ubiquitination by TRAF6 in tumor invasion and metastasis.
24407422 2014 Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...