Property Summary

NCBI Gene PubMed Count 17
PubMed Score 40.18
PubTator Score 33.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q99536 A8K345 B0AZP7 B4DPX4 Q13035 Q5BKZ7 Q96A39 Q9BUT8
Symbols VATI

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of vesicle amine transport 1 (VAT1) expression by HIV-1 Vpr in Vpr transduced macrophages
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of vesicle amine transport 1 (VAT1) expression by HIV-1 Vpr in Vpr transduced macrophages
21394740 We demonstrate that VAT-1 is a novel pathogenic factor in benign prostatic hyperplasia associated with cell proliferation.
20858461 The role of phospholipase D in the transport of VAT1 to plasma membranes and in phosphatidic acid metabolism in neutrophils is reported.
19508442 VAT-1 is overexpressed in glioblastomas and functionally involved in glioma cell migration, representing a new component involved in glioma invasion

AA Sequence

MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYDKVKLQSRPAA      1 - 70
PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNRS     71 - 140
GMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVHMAAGGVGMAAVQLCR    141 - 210
TVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMG    211 - 280
KVVTYGMANLLTGPKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYN    281 - 350
QGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN                               351 - 393
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21394740 2011 VAT-1 is a novel pathogenic factor of progressive benign prostatic hyperplasia.
21269460 2011 Initial characterization of the human central proteome.
20858461 2011 An essential role for phospholipase D in the recruitment of vesicle amine transport protein-1 to membranes in human neutrophils.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19508442 2009 Vesicle amine transport protein-1 (VAT-1) is upregulated in glioblastomas and promotes migration.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...