Property Summary

NCBI Gene PubMed Count 180
Grant Count 220
R01 Count 127
Funding $20,130,846.53
PubMed Score 639.41
PubTator Score 333.46

Knowledge Summary

Patent (11,601)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
medulloblastoma, large-cell -1.100 0.002
pancreatic ductal adenocarcinoma liver m... -1.053 0.014
non-small cell lung cancer -1.236 0.000
breast carcinoma -1.500 0.003
fibroadenoma -2.000 0.040
lung adenocarcinoma -2.400 0.000
gastric carcinoma -2.200 0.030
ductal carcinoma in situ -1.100 0.004

Synonym

Accession Q99527 A8K6C5 B5BUJ1 O00143 O43494 Q13631 Q6FHL1 Q96F42 Q99981
Symbols mER
CEPR
GPER
DRY12
FEG-1
GPR30
LERGU
LyGPR
CMKRL2
LERGU2
GPCR-Br

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (137)

PMID Text
26815911 Expression and functional roles of estrogen receptor GPR30 in human intervertebral disc
26772481 Understanding the molecular basis of agonist/antagonist mechanism of GPER1/GPR30 through structural and energetic analyses
26731262 Data show that estrogen mediates control of hepatitis C virus through the G-protein-coupled estrogen receptor 30 (GPR30) pathway leading to cleavage of occludin by Matrix Metalloproteinase-9 (MMP-9).
26646587 Data show that both mineralcorticoid receptor (MR) and G-protein estrogen receptor (GPER) contribute to the proliferation and migration of breast and endothelial cancer cells by sodium-hydrogen exchanger 1 protein (NHE-1) upon aldosterone exposure.
26638889 GPER significantly attenuated the inhibition effect of miR-424 in estradiol-induced cell growth in the endometrial cancer cells.
26617848 Evaluation of GPER1, EGFR and CXCR1 mRNA/protein expression may be helpful in differential diagnosis of malignant follicular thyroid carcinoma and benign follicular thyroid adenoma.
26526233 GPER ligand-independently stimulates the proliferation, migration and invasion of SKOV3 cells.
26506594 Studies indicate that prostate cancer stem cells lack the androgen receptor, and express classical alpha and/or beta and GPR30 estrogen receptors.
26470790 Our results further suggest that GPER expression and FOXO3a localization could be utilized as prognostic markers in breast cancer therapy and that GPER antagonists could promote apoptosis in GPER-positive breast cancers
26416628 Results indicate that GPER-1 mediates proliferation of estrogen-induced leiomyoma cells by activating the MAPK pathway, and not by promoting mitosis.
More...

AA Sequence

MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLF      1 - 70
PIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVN     71 - 140
MYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFAD    141 - 210
VREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFIS    211 - 280
VHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNR    281 - 350
FCHAALKAVIPDSTEQSDVRFSSAV                                                 351 - 375
//

Text Mined References (189)

PMID Year Title
26815911 2016 Expression and functional roles of estrogen receptor GPR30 in human intervertebral disc.
26772481 2016 Understanding the molecular basis of agonist/antagonist mechanism of GPER1/GPR30 through structural and energetic analyses.
26731262 2016 A New Signaling Pathway for HCV Inhibition by Estrogen: GPR30 Activation Leads to Cleavage of Occludin by MMP-9.
26646587 2016 GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells.
26638889 2015 MicroRNA-424 suppresses estradiol-induced cell proliferation via targeting GPER in endometrial cancer cells.
26617848 2015 Role of GPER1, EGFR and CXCR1 in differentiating between malignant follicular thyroid carcinoma and benign follicular thyroid adenoma.
26526233 2015 Role of GPER on proliferation, migration and invasion in ligand-independent manner in human ovarian cancer cell line SKOV3.
26506594 2016 Prostate cancer stem cells: the role of androgen and estrogen receptors.
26470790 2015 Estrogen-mediated inactivation of FOXO3a by the G protein-coupled estrogen receptor GPER.
26416628 2015 G protein-coupled estrogen receptor 1 (GPER 1) mediates estrogen-induced, proliferation of leiomyoma cells.
More...