Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.32
PubTator Score 65.33

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYA      1 - 70
VTNTEHAKRKTVTAMAVVYVLKRQGRTL                                               71 - 98
//

Text Mined References (13)

PMID Year Title