Property Summary

Ligand Count 16
NCBI Gene PubMed Count 142
PubMed Score 235.84
PubTator Score 111.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.200 2.0e-02
atypical teratoid / rhabdoid tumor 1.200 9.6e-03
cystic fibrosis -1.509 4.7e-05
Down syndrome 1.100 1.5e-03
ependymoma 1.300 1.7e-02
esophageal adenocarcinoma -1.200 3.2e-02
glioblastoma 1.100 1.7e-02
group 4 medulloblastoma -1.500 1.8e-04
lung cancer -1.900 4.2e-03
medulloblastoma, large-cell 1.800 3.8e-04
mucosa-associated lymphoid tissue lympho... 1.692 7.2e-03
non-small cell lung cancer -1.261 1.4e-17
oligodendroglioma 1.500 3.9e-03
ovarian cancer 2.000 1.8e-08
pediatric high grade glioma 1.300 2.0e-02
psoriasis 1.300 2.2e-04
tuberculosis 1.800 5.7e-06

Gene RIF (96)

AA Sequence

MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFP      1 - 70
RGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFG     71 - 140
QSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQT    141 - 210
DLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKAD    211 - 280
LGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQF    281 - 350
YSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLS    351 - 420
EDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIA    421 - 490
HGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTY    491 - 560
TFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDY    561 - 630
EDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLE    631 - 700
FCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVT    701 - 770
VVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE             771 - 831
//

Text Mined References (148)

PMID Year Title