Property Summary

NCBI Gene PubMed Count 128
Grant Count 124
R01 Count 78
Funding $14,456,767.91
PubMed Score 203.06
PubTator Score 111.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.200 0.020
ependymoma 1.300 0.017
oligodendroglioma 1.500 0.004
esophageal adenocarcinoma -1.200 0.032
psoriasis 1.300 0.000
group 4 medulloblastoma -1.500 0.000
cystic fibrosis -1.515 0.000
glioblastoma 2.100 0.002
atypical teratoid/rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell 1.800 0.000
tuberculosis 2.000 0.000
non-small cell lung cancer -1.261 0.000
lung cancer -1.900 0.004
pediatric high grade glioma 1.300 0.020
mucosa-associated lymphoid tissue lympho... 1.692 0.007
ovarian cancer 2.000 0.000
Down syndrome 1.100 0.002

Synonym

Accession Q99523 B4DWI3 C0JYZ0 Q8IZ49
Symbols NT3
Gp95
NTR3
LDLCQ6

Gene

PANTHER Protein Class (1)

PDB

3F6K   4PO7   3G2U   3G2V   4MSL   4N7E  

Gene RIF (83)

PMID Text
26950419 Sortilin mediates vascular calcification via its recruitment into extracellular vesicles.
26566674 highly expressed by infiltrated perivascular myeloid cells, mainly in vessel cuffs, in the CNS of patients suffering from multiple sclerosi
26556286 Sortilin has been found to inhibit the conversion of proBDNF into mature BDNF by plasmin and to protect neurons from the apoptotic properties of proBDNF.
26464717 no association was found between the SNPs of rs599839, rs464218 and rs6698843 at the CELSR2-PSRC1-SORT1 and the risk of coronary artery disease or ischemic stroke
26375028 Variants near SORT1 is associated with dyslipidemia.
26370502 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26331452 Inverse association between hepatic SORT1 gene expression and hepatic HBsAg expression indicates the possible role of sortilin in HBsAg particle formation.
26297037 The study demostrated that the sortilin deficiency caused by the SORT1 p.G171A mutation may lead to defects in neurotransmission, giving rise to the development of tremor.
26261636 SNPs in SORT1, CETP and GCKR were individually associated with lipid level variations in Algerian population.
26085104 We conclude that PCSK9 enhances the degradation of the LDLR independently of either APLP2 or sortilin both ex vivo and in mice.
More...

AA Sequence

MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFP      1 - 70
RGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFG     71 - 140
QSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQT    141 - 210
DLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKAD    211 - 280
LGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQF    281 - 350
YSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLS    351 - 420
EDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIA    421 - 490
HGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTY    491 - 560
TFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDY    561 - 630
EDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLE    631 - 700
FCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVT    701 - 770
VVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE             771 - 831
//

Text Mined References (135)

PMID Year Title
26950419 2016 Sortilin mediates vascular calcification via its recruitment into extracellular vesicles.
26566674 2015 Role of Sortilin in Models of Autoimmune Neuroinflammation.
26556286 2015 Increased serum levels of sortilin are associated with depression and correlated with BDNF and VEGF.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26464717 2015 Association of variants in CELSR2-PSRC1-SORT1 with risk of serum lipid traits, coronary artery disease and ischemic stroke.
26375028 2015 Genetic Contribution of Variants near SORT1 and APOE on LDL Cholesterol Independent of Obesity in Children.
26370502 2015 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26331452 2016 The possible impact of sortilin in reducing HBsAg expression in chronic hepatitis B.
26297037 SORT1 Mutation Resulting in Sortilin Deficiency and p75(NTR) Upregulation in a Family With Essential Tremor.
26261636 2015 Associations of common SNPs in the SORT1, GCKR, LPL, APOA1, CETP, LDLR, APOE genes with lipid trait levels in an Algerian population sample.
More...