Property Summary

NCBI Gene PubMed Count 69
Grant Count 17
R01 Count 15
Funding $1,482,557.32
PubMed Score 112.45
PubTator Score 5959.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.147 0.001
glioblastoma 1.300 0.009
medulloblastoma, large-cell -1.100 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.007
ulcerative colitis -1.600 0.000
ovarian cancer 1.400 0.000

Gene RIF (44)

PMID Text
26768362 Our study shows that the 340-cavity is not an occasional or atypical domain in NA subtypes, and it has potential to function as a new hotspot for influenza drug binding.
26463994 NEU1 siRNA can effectively inhibit proliferation, apoptosis, and invasion of human ovarian cancer cells by targeting lysosome and oxidative phosphorylation signaling, which can serve as a new target ovarian cancer treatment
26455375 How the point mutations of the neuraminidase sequences affected the susceptibility of H9N2 virus to oseltamivir is still to be determined and deserve further investigations
26185093 Neu1 desialylation is a mechanism of Fc-independent platelet clearance in immune thrombocytopenia.
26086247 Basal Neu-1 catalytic activity is strongly increased in aged cells.
25963144 Flagellin drives NEU1 to desialylate MUC1, thereby increasing its adhesiveness for Pseudomonas aeruginosa and its shedding
25925251 Muc1 clearly plays a significant role in enhancing the hypoxia-inducible transcription factors protective pathway during ischemic insult and recovery in kidney epithelia
25600812 This study analyzed patient cells with GM1 gangliosidosis and sialidosis. A novel mutation p.R347Q is identified in NEU1 gene.
25566667 The lymphocyte levels of NEU1 and ST6GAL1 mRNA expression are significantly increased in erythremia.
24808020 Sialidosis should be suspected and the NEU1 gene analyzed in patients with isolated action myoclonus presenting in adulthood in the absence of other typical clinical and laboratory findings.
More...

AA Sequence

MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQ      1 - 70
IGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLG     71 - 140
AVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREP    141 - 210
RKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINAR    211 - 280
NQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSF    281 - 350
SNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL         351 - 415
//

Text Mined References (71)

PMID Year Title
26768362 2016 The 340-cavity in neuraminidase provides new opportunities for influenza drug development: A molecular dynamics simulation study.
26463994 2016 Effects of sialidase NEU1 siRNA on proliferation, apoptosis, and invasion in human ovarian cancer.
26455375 Oseltamivir activity against avian influenza H9N2 strain with different point mutations in their neuraminidase.
26185093 2015 Desialylation is a mechanism of Fc-independent platelet clearance and a therapeutic target in immune thrombocytopenia.
26086247 2015 Uncoupling of Elastin Complex Receptor during In Vitro Aging Is Related to Modifications in Its Intrinsic Sialidase Activity and the Subsequent Lactosylceramide Production.
25963144 2015 NEU1 Sialidase Regulates Membrane-tethered Mucin (MUC1) Ectodomain Adhesiveness for Pseudomonas aeruginosa and Decoy Receptor Release.
25925251 2015 Muc1 is protective during kidney ischemia-reperfusion injury.
25600812 2015 Biochemical and molecular characterization of novel mutations in GLB1 and NEU1 in patient cells with lysosomal storage disorders.
25566667 2014 [Glycoprotein sialylation and NEU1 and ST6GAL1 expressions in erythremia].
24808020 2014 Expanding sialidosis spectrum by genome-wide screening: NEU1 mutations in adult-onset myoclonus.
More...