Property Summary

NCBI Gene PubMed Count 36
PubMed Score 18.46
PubTator Score 51.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.32226001286929E-29
lung carcinoma 2844 5.85320518476296E-28
non-small cell lung cancer 2798 2.26265823173196E-27
adrenocortical carcinoma 1427 7.14531585279993E-16
lung adenocarcinoma 2714 6.77782031927284E-13
lung cancer 4473 5.42466702940992E-8
ovarian cancer 8492 3.75536304094636E-6
posterior fossa group A ependymoma 1511 6.2593801256847E-6
ductal carcinoma in situ 1745 7.83181846174246E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.01507781805593E-5
osteosarcoma 7933 4.74903690842745E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.34118754356455E-5
invasive ductal carcinoma 2950 6.99525596864288E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.03056617908714E-4
pituitary cancer 1972 7.8952526859726E-4
Pick disease 1893 0.00120902028017899
psoriasis 6685 0.00423466815214632
non diabetic and post-ischemic heart failure 200 0.00834140410062391
mucosa-associated lymphoid tissue lymphoma 480 0.00875886579812281
adrenocortical adenoma 134 0.0090132210871574
esophageal adenocarcinoma 737 0.0176010007179145
cutaneous lupus erythematosus 1056 0.0223740592597417
Breast cancer 3099 0.0230083177701463
cystic fibrosis 1670 0.0237484221907163
group 3 medulloblastoma 2254 0.0358246227021881
type II diabetes mellitus and post-ischemic heart failure 89 0.0467110834324519
Disease Target Count Z-score Confidence
Invasive lobular carcinoma 6 3.009 1.5

Expression

Synonym

Accession Q99518 Q5EBX4 Q86U73 Q9BRX1
Symbols FMO1B1

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Gene RIF (10)

PMID Text
20529763 Observational study of gene-disease association. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19420133 Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K.
18794725 analysis of how the functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa
18794725 Observational study of genotype prevalence. (HuGE Navigator)
15864117 Observational study of genotype prevalence. (HuGE Navigator)
15864117 analysis of flavin-containing monooxygenase isoform 2 (FMO2) polymorphisms in Hispanics
15355885 Observational study of genotype prevalence. (HuGE Navigator)
11042094 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVTNTSKEMSCFS      1 - 70
DFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVF     71 - 140
DAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQV    141 - 210
FISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMK    211 - 280
EPVLNDDVPSRLLCGAIKVKSTVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMV    281 - 350
SLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF    351 - 420
GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY                       421 - 471
//

Text Mined References (37)

PMID Year Title
24561181 2014 Mammalian flavin-containing monooxygenase (FMO) as a source of hydrogen peroxide.
22830265 2012 [Association of rs10912745 and rs4916375 polymorphisms located in the cluster of flavin-containing monooxygenase genes, with ischaemic cardioembolic stroke].
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19420133 2009 Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K.
18948378 2009 Human flavin-containing monooxygenase 2.1 catalyzes oxygenation of the antitubercular drugs thiacetazone and ethionamide.
18930751 2008 Metabolism of the anti-tuberculosis drug ethionamide by mouse and human FMO1, FMO2 and FMO3 and mouse and human lung microsomes.
18794725 2008 The potentially deleterious functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa.
More...