Property Summary

NCBI Gene PubMed Count 36
Grant Count 12
R01 Count 12
Funding $2,945,127.5
PubMed Score 18.46
PubTator Score 51.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
20529763 Observational study of gene-disease association. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19420133 Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K.
18794725 analysis of how the functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa
18794725 Observational study of genotype prevalence. (HuGE Navigator)
15864117 Observational study of genotype prevalence. (HuGE Navigator)
15864117 analysis of flavin-containing monooxygenase isoform 2 (FMO2) polymorphisms in Hispanics
15355885 Observational study of genotype prevalence. (HuGE Navigator)
11042094 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVTNTSKEMSCFS      1 - 70
DFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVF     71 - 140
DAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQV    141 - 210
FISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMK    211 - 280
EPVLNDDVPSRLLCGAIKVKSTVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMV    281 - 350
SLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF    351 - 420
GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY                       421 - 471
//

Text Mined References (37)

PMID Year Title
24561181 2014 Mammalian flavin-containing monooxygenase (FMO) as a source of hydrogen peroxide.
22830265 2012 [Association of rs10912745 and rs4916375 polymorphisms located in the cluster of flavin-containing monooxygenase genes, with ischaemic cardioembolic stroke].
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19420133 2009 Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K.
18948378 2009 Human flavin-containing monooxygenase 2.1 catalyzes oxygenation of the antitubercular drugs thiacetazone and ethionamide.
18930751 2008 Metabolism of the anti-tuberculosis drug ethionamide by mouse and human FMO1, FMO2 and FMO3 and mouse and human lung microsomes.
18794725 2008 The potentially deleterious functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa.
More...