Property Summary

NCBI Gene PubMed Count 37
PubMed Score 20.43
PubTator Score 51.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma -1.338 1.4e-02
adrenocortical carcinoma -4.035 2.5e-14
Breast cancer -3.200 3.0e-02
breast carcinoma -1.300 2.1e-03
cutaneous lupus erythematosus 1.400 2.2e-02
cystic fibrosis 1.800 2.4e-02
ductal carcinoma in situ -3.200 7.8e-06
ependymoma 1.200 3.2e-03
esophageal adenocarcinoma -2.400 1.8e-02
group 3 medulloblastoma -1.100 3.6e-02
intraductal papillary-mucinous adenoma (... -2.200 1.0e-05
intraductal papillary-mucinous carcinoma... -2.200 6.3e-05
intraductal papillary-mucinous neoplasm ... -2.300 3.0e-04
invasive ductal carcinoma -1.463 2.3e-03
lung adenocarcinoma -2.400 2.3e-14
lung cancer -4.400 4.9e-06
lung carcinoma -4.400 5.9e-28
mucosa-associated lymphoid tissue lympho... 1.137 8.8e-03
non diabetic and post-ischemic heart fai... 1.300 8.3e-03
non-small cell lung cancer -3.671 2.3e-27
osteosarcoma -2.234 7.2e-03
ovarian cancer 1.500 3.8e-06
Pick disease 1.700 1.2e-03
pituitary cancer -2.100 7.9e-04
psoriasis 2.000 4.2e-03
type II diabetes mellitus and post-ische... 1.200 4.7e-02

Gene RIF (11)

AA Sequence

MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVTNTSKEMSCFS      1 - 70
DFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVF     71 - 140
DAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQV    141 - 210
FISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMK    211 - 280
EPVLNDDVPSRLLCGAIKVKSTVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMV    281 - 350
SLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF    351 - 420
GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY                       421 - 471
//

Text Mined References (38)

PMID Year Title