Tbio | Dimethylaniline monooxygenase [N-oxide-forming] 2 |
Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive.
This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Comments
Disease | Target Count |
---|---|
Endometriosis | 535 |
Peripheral Neuropathy | 303 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Invasive lobular carcinoma | 6 | 3.009 | 1.5 |
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG |
Platypus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
20529763 | Observational study of gene-disease association. (HuGE Navigator) |
20173083 | Observational study of genotype prevalence. (HuGE Navigator) |
19898482 | Observational study of gene-disease association. (HuGE Navigator) |
19420133 | Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K. |
18794725 | analysis of how the functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa |
18794725 | Observational study of genotype prevalence. (HuGE Navigator) |
15864117 | Observational study of genotype prevalence. (HuGE Navigator) |
15864117 | analysis of flavin-containing monooxygenase isoform 2 (FMO2) polymorphisms in Hispanics |
15355885 | Observational study of genotype prevalence. (HuGE Navigator) |
11042094 | Observational study of genotype prevalence. (HuGE Navigator) |
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVTNTSKEMSCFS 1 - 70 DFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVF 71 - 140 DAVMVCSGHHILPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQV 141 - 210 FISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMK 211 - 280 EPVLNDDVPSRLLCGAIKVKSTVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMV 281 - 350 SLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLF 351 - 420 GESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNSY 421 - 471 //
PMID | Year | Title |
---|---|---|
24561181 | 2014 | Mammalian flavin-containing monooxygenase (FMO) as a source of hydrogen peroxide. |
22830265 | 2012 | [Association of rs10912745 and rs4916375 polymorphisms located in the cluster of flavin-containing monooxygenase genes, with ischaemic cardioembolic stroke]. |
20529763 | 2010 | Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE. |
20388717 | 2010 | In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification. |
20173083 | 2010 | Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans. |
19898482 | 2009 | Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy. |
19420133 | 2009 | Characterization of sulfoxygenation and structural implications of human flavin-containing monooxygenase isoform 2 (FMO2.1) variants S195L and N413K. |
18948378 | 2009 | Human flavin-containing monooxygenase 2.1 catalyzes oxygenation of the antitubercular drugs thiacetazone and ethionamide. |
18930751 | 2008 | Metabolism of the anti-tuberculosis drug ethionamide by mouse and human FMO1, FMO2 and FMO3 and mouse and human lung microsomes. |
18794725 | 2008 | The potentially deleterious functional variant flavin-containing monooxygenase 2*1 is at high frequency throughout sub-Saharan Africa. |
More... |